Recombinant Oryza sativa subsp. japonica CASP-like protein Os07g0692200 (Os07g0692200, LOC_Os07g49200)

Shipped with Ice Packs
In Stock

Description

Functional Insights from Comparative Studies

Comparative genomic analyses reveal that Os07g0692200 (annotated as OsCASPL4B1) shares evolutionary relationships with Arabidopsis CASPs involved in Casparian strip formation :

Key functional attributes:

  • Membrane domain scaffolding: Participates in forming diffusion barriers at endodermal cells .

  • Stress response: Upregulated under salt stress, influencing ion homeostasis (e.g., Na⁺/K⁺ balance) .

  • Lignin deposition: Interacts with peroxidases to direct localized lignin polymerization, critical for Casparian strip integrity .

Evolutionary conservation:

FeatureRice (OsCASPs)Arabidopsis (AtCASPs)
Amino acid range153–421 residues152–297 residues
Subfamilies6 subfamilies6 subfamilies
Ka/Ks ratios<1 (purifying selection)<1 (purifying selection)

Phylogenetic analysis clusters Os07g0692200 within the CASP_like-III subfamily, which is enriched in stress-responsive regulatory elements (e.g., ABRE for abscisic acid signaling) .

3.1. Recombinant Protein Use Cases

  • Antigen production: Utilized in antibody generation for immunolocalization studies .

  • Enzymatic assays: Serves as a substrate to study CASP-peroxidase interactions in lignin synthesis .

3.2. Mutant Phenotypes

Knockout studies of homologous CASP proteins (e.g., OsCASP1) demonstrate:

  • Delayed Casparian strip formation in roots .

  • Ectopic suberin deposition, altering nutrient uptake efficiency .

  • Reduced tiller number and withered leaves under salt stress .

Future Directions

  • Structural studies: Cryo-EM analysis to resolve transmembrane domain interactions.

  • Crop engineering: Targeting Os07g0692200 to develop rice varieties with enhanced nutrient-use efficiency under abiotic stress.

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific requirements for the format, please indicate them in your order notes. We will fulfill your request whenever possible.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributor for specific delivery estimates.
Note: All our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please communicate this to us in advance. Additional fees may apply.
Notes
Repeated freezing and thawing is not recommended. For optimal results, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents are at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%, serving as a reference for your own protocols.
Shelf Life
The shelf life is influenced by various factors, including storage conditions, buffer composition, temperature, and the intrinsic stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type in mind, please inform us and we will prioritize its development.
Synonyms
Os07g0692200; LOC_Os07g49200; P0034A04.117; CASP-like protein 4B1; OsCASPL4B1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-199
Protein Length
full length protein
Species
Oryza sativa subsp. japonica (Rice)
Target Names
Os07g0692200
Target Protein Sequence
MAMVASPDDIVKSPLPPPPPPPPPPLPPAHKDKAAYNPYSGCPAHGGDDGLDGIVLVLRA AAALLALVAMALVASCRHGDWMEFTRYQEYRYLLGVAVVASLYSALQAARTFRRMRAGTA YAATFLDFAGDQAVGYLLITASSAALPITIRMRSAVVNTFTDVVAASISFAFLAFAALAF SALIAGFRLSSSSSSAYNY
Uniprot No.

Target Background

Protein Families
Casparian strip membrane proteins (CASP) family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is Os07g0692200 and what is its structural characterization?

Os07g0692200 is a CASP-like protein found in Oryza sativa subsp. japonica (rice). It belongs to the Casparian strip membrane domain protein family, which plays crucial roles in forming transmembrane scaffolds that recruit lignin biosynthetic enzymes for Casparian strip formation . The protein consists of 199 amino acids in its full-length form . Like other CASP proteins, it likely contains multiple transmembrane domains that facilitate its localization to the plasma membrane at the Casparian strip domain.

Structural analysis indicates the following characteristics:

PropertyDescription
Full Length199 amino acids
Expression SystemE. coli
Available TagsHis-tag
Predicted DomainsTransmembrane domains (typical of CASP family)

How does Os07g0692200 relate to the CASP protein family?

Os07g0692200 belongs to the CASP (Casparian Strip membrane domain Protein) family, which was first characterized in Arabidopsis. These proteins form a transmembrane scaffold that recruits lignin biosynthetic enzymes to facilitate Casparian strip formation . The Casparian strip is a specialized cell wall modification in the endodermis of plant roots that controls the movement of water and solutes between the cortex and the stele.

In rice, CASP-like proteins such as Os07g0692200 appear to function similarly to their Arabidopsis counterparts, though with adaptations specific to rice root architecture. Rice, being a semi-aquatic plant, has evolved a more complex root structure than Arabidopsis to adapt to its growing conditions . These adaptations include differences in lignin and suberin deposition patterns, which are crucial for the plant's adaptive responses to its environment.

What methodologies are used to produce recombinant Os07g0692200?

Recombinant Os07g0692200 protein can be produced using standard molecular cloning and protein expression techniques. Based on available information, the following methodology is commonly employed:

  • Gene isolation: The coding sequence of Os07g0692200 is amplified from Oryza sativa subsp. japonica cDNA using PCR with gene-specific primers.

  • Cloning: The amplified sequence is cloned into an expression vector containing a His-tag sequence, allowing for subsequent protein purification.

  • Transformation: The recombinant vector is transformed into E. coli expression hosts .

  • Protein expression: Bacterial cultures are induced with IPTG or similar inducers to express the recombinant protein.

  • Purification: The His-tagged recombinant protein is purified using nickel affinity chromatography.

This approach yields full-length (1-199 amino acids) His-tagged Os07g0692200 protein that can be used for various research applications .

How does rice Os07g0692200 compare with its orthologs in other plant species?

Comparative genomic analysis reveals both similarities and differences between rice Os07g0692200 and related proteins in other plant species:

When compared to Arabidopsis CASPs, the rice protein shows functional conservation in terms of its role in Casparian strip formation, but with notable adaptations specific to rice root anatomy. Rice, as a semi-aquatic plant, has developed a distinct root structure compared to Arabidopsis, which is reflected in the differential patterns of lignin and suberin deposition .

The evolutionary relationships between rice and Arabidopsis orthologs can be understood in the context of their divergence from a common ancestor. Ortholog pairs between these species show an average evolutionary distance of 0.42 by p distance, with a mean distance of 0.70 when estimated by Poisson-γ correction . This suggests significant evolutionary time for functional divergence while maintaining core functions.

What is the role of Os07g0692200 in Casparian strip formation and root development?

Os07g0692200, as a CASP-like protein, likely plays a critical role in the formation of the Casparian strip in rice roots. Research on related proteins indicates that CASPs form a transmembrane scaffold that recruits lignin biosynthetic enzymes for Casparian strip formation . The Casparian strip serves as a diffusion barrier in the root endodermis, controlling the movement of water and solutes between the cortex and the stele.

In rice, the structure and development timing of the Casparian strip differ from those in Arabidopsis . These differences likely reflect adaptations to rice's semi-aquatic growth habitat. The formation of the Casparian strip in rice involves complex patterns of lignin and suberin deposition, which are essential for the plant's ability to control water and nutrient uptake in water-saturated soils.

Experimental evidence from Oscasp1 mutants shows altered patterns of lignin and suberin deposition in the roots, highlighting the importance of CASP proteins in proper root barrier formation . This suggests that Os07g0692200 may have a similar function, potentially working in concert with other CASP family members to establish proper root barrier properties.

What phenotypic changes are observed in Os07g0692200 mutants?

While the search results don't provide specific information about Os07g0692200 mutants, studies on related CASP mutants in rice provide valuable insights. Research on Oscasp1 mutants has revealed:

  • Altered patterns of lignin and suberin deposition in both primary roots and small lateral roots (SLRs) .

  • Modified structure of the Casparian strip compared to wild-type plants .

  • Potential impacts on nutrient homeostasis and adaptation to different growth environments .

These findings suggest that mutations in Os07g0692200 might similarly affect root barrier properties, potentially impacting the plant's ability to control water and nutrient uptake. The specific phenotypic changes would depend on the degree of functional redundancy among CASP family members and the particular role of Os07g0692200 in the formation of the Casparian strip.

How can researchers investigate Os07g0692200 function using molecular approaches?

To investigate the function of Os07g0692200, researchers can employ several molecular approaches:

  • Gene knockout/knockdown studies: CRISPR-Cas9 genome editing or RNAi can be used to create Os07g0692200 mutants or knockdown lines. Phenotypic analysis of these plants, focusing on root development, Casparian strip formation, and stress responses, can reveal the protein's function.

  • Protein localization: Fluorescent protein fusions (GFP, YFP, etc.) can determine the subcellular localization of Os07g0692200, confirming its presence in the Casparian strip domain of the endodermal cells.

  • Protein interaction studies: Techniques such as yeast two-hybrid, co-immunoprecipitation, or pull-down assays using the recombinant His-tagged protein can identify interaction partners, providing insights into the protein's functional network.

  • Expression analysis: qRT-PCR, RNA-seq, or promoter-reporter constructs can characterize the expression patterns of Os07g0692200 under different developmental stages and environmental conditions.

  • Complementation studies: Introducing the wild-type Os07g0692200 gene into mutants to rescue the phenotype confirms the gene's role in observed defects.

  • Cross-species complementation: Testing whether Os07g0692200 can rescue phenotypes of CASP mutants in Arabidopsis, or vice versa, can reveal the degree of functional conservation across species.

What is the role of Os07g0692200 in nutrient homeostasis and stress adaptation?

Research on related CASP proteins suggests that Os07g0692200 likely plays an important role in nutrient homeostasis and adaptation to different growth environments . The Casparian strip, which CASP proteins help to form, functions as a selective barrier controlling the movement of water and dissolved minerals between the root cortex and the vascular system.

In rice, which often grows in flooded conditions, the regulation of nutrient uptake is particularly important for maintaining proper ionic balance. The proper formation of the Casparian strip is crucial for:

  • Controlling uptake of essential nutrients (e.g., potassium, phosphorus, nitrogen)

  • Limiting entry of potentially toxic elements (e.g., sodium, heavy metals)

  • Regulating water transport

  • Adapting to conditions of nutrient deficiency or excess

Studies on Oscasp1 suggest that CASP proteins in rice play a critical role in these processes . By extension, Os07g0692200 likely contributes to rice's ability to maintain nutrient homeostasis and adapt to various environmental conditions, though the specific aspects of nutrient regulation it influences require further investigation.

How does Os07g0692200 compare to its homologs in the rice genome?

The rice genome contains multiple CASP-like proteins that likely arose through gene duplication events. When considering genome evolution in rice compared to Arabidopsis, studies indicate that both genomes have undergone independent duplication events resulting in paralogous genes .

Comparative analysis reveals:

  • Rice has acquired approximately 5320 duplicate genes, while Arabidopsis has 5929 .

  • The distribution pattern of paralog clusters is similar between rice and Arabidopsis, despite their independent genome duplication histories .

  • Natural selection has likely played a role in shaping gene duplication patterns, with some genes remaining as single copies while others have been duplicated .

For Os07g0692200 specifically, its relationship with other CASP-like proteins in rice would follow similar evolutionary patterns. The retention and functional diversification of CASP paralogs in rice likely reflect their importance in root development and adaptation to rice's semi-aquatic habitat.

What experimental approaches are optimal for studying Os07g0692200 function in rice?

To comprehensively study Os07g0692200 function, researchers should consider a multi-faceted experimental approach:

  • Genetic approaches:

    • Generate CRISPR-Cas9 knockout mutants of Os07g0692200

    • Create RNAi lines for conditional knockdown

    • Develop overexpression lines to assess gain-of-function phenotypes

  • Histochemical analyses:

    • Use lignin-specific stains (e.g., phloroglucinol-HCl) to visualize Casparian strip formation

    • Apply suberin-specific dyes (e.g., Fluorol Yellow 088) to examine suberin lamellae

    • Employ apoplastic tracers to assess barrier function

  • Microscopy techniques:

    • Confocal microscopy of fluorescent protein fusions

    • Transmission electron microscopy to examine Casparian strip ultrastructure

    • Light microscopy of cross-sections to observe anatomical changes

  • Physiological assays:

    • Measure hydraulic conductivity of roots

    • Analyze nutrient uptake and translocation

    • Assess responses to various abiotic stresses (drought, salinity, nutrient deficiency)

  • Molecular analyses:

    • Conduct RNA-seq to identify genes affected by Os07g0692200 mutation

    • Perform ChIP-seq if transcriptional regulation is suspected

    • Use proteomics to identify interacting partners

How can recombinant Os07g0692200 be utilized in functional studies?

The recombinant His-tagged Os07g0692200 protein can be utilized in various functional studies:

  • Antibody production: The purified protein can be used to generate specific antibodies for immunolocalization and Western blot analyses.

  • In vitro binding assays: The protein can be employed in assays to identify potential interacting partners, including other proteins involved in Casparian strip formation.

  • Enzymatic assays: If Os07g0692200 possesses enzymatic activity, the recombinant protein can be used to characterize its biochemical properties.

  • Structural studies: X-ray crystallography or nuclear magnetic resonance (NMR) spectroscopy can determine the three-dimensional structure of the protein, providing insights into its function.

  • Ligand binding studies: Surface plasmon resonance (SPR) or isothermal titration calorimetry (ITC) can determine whether the protein binds specific molecules.

  • Reconstitution experiments: The protein can be incorporated into artificial membrane systems to study its role in membrane organization.

What challenges might researchers encounter when investigating Os07g0692200?

Researchers investigating Os07g0692200 should be aware of several potential challenges:

  • Functional redundancy: As part of a protein family, other CASP-like proteins may compensate for the loss of Os07g0692200, potentially masking phenotypes in single mutants. To address this, consider creating multiple mutants targeting several family members simultaneously.

  • Developmental timing: The timing of Casparian strip formation in rice differs from Arabidopsis , necessitating careful consideration of developmental stages when conducting experiments.

  • Technical challenges in root imaging: Rice roots have a complex structure , making high-resolution imaging of the Casparian strip technically challenging. Advanced microscopy techniques and careful sample preparation are required.

  • Environmental variables: As Os07g0692200 likely plays a role in environmental adaptation , experimental conditions must be carefully controlled and varied to fully understand its function.

  • Protein solubility: CASP proteins contain multiple transmembrane domains, potentially causing solubility issues during recombinant protein production. Optimization of expression and purification protocols may be necessary.

How has Os07g0692200 evolved compared to its orthologs in other plant species?

Evolutionary analysis of Os07g0692200 can provide insights into its functional adaptation across different plant species:

Comparison between rice and Arabidopsis genomes reveals that these distantly related flowering plants share similar sets of functional domains despite differences in their gene repertoires . The average evolutionary distance between ortholog pairs is 0.42 by p distance (0.70 when estimated by Poisson-γ correction with a shape parameter of 2.25) .

In the specific case of CASP-like proteins, the evolutionary trajectory likely reflects adaptations to different root environments and structures. Rice, as a semi-aquatic plant, has evolved a root system with adaptations for growth in water-saturated, often anaerobic soils. These adaptations include specialized patterns of lignin and suberin deposition , which are influenced by CASP proteins.

The following table summarizes key evolutionary aspects:

Evolutionary AspectDescription
Ortholog Evolutionary DistanceAverage 0.42 (p distance) between rice and Arabidopsis orthologs
Selective PressureNatural selection likely influenced gene duplication patterns
Functional AdaptationAdaptation to semi-aquatic environment in rice vs. terrestrial in Arabidopsis
Structural DifferencesDifferent timing and structure of Casparian strip formation

What can comparative genomics reveal about Os07g0692200 function?

Comparative genomics approaches can provide valuable insights into the function of Os07g0692200 by examining conserved features across species:

  • Synteny analysis: Examining the genomic context of Os07g0692200 and its orthologs in other species can reveal conserved gene clusters that might indicate functional relationships.

  • Identification of conserved domains: Comparison of protein sequences across species can highlight highly conserved domains that are likely critical for function.

  • Analysis of selection pressure: Calculating the ratio of nonsynonymous to synonymous substitutions (dN/dS) can indicate whether the gene has been under purifying, neutral, or positive selection.

  • Co-expression network comparison: Comparing co-expression networks across species can identify conserved gene modules that include Os07g0692200, suggesting functional associations.

  • Exploitation of rice-Arabidopsis genomic resources: The extensive genomic resources available for both rice and Arabidopsis can be leveraged to identify conserved regulators and interacting partners .

By integrating these comparative approaches, researchers can develop testable hypotheses about Os07g0692200 function based on evolutionary conservation and divergence patterns.

How might Os07g0692200 contribute to improving rice stress tolerance?

Given the role of CASP proteins in forming root barriers critical for nutrient and water homeostasis , Os07g0692200 potentially represents a valuable target for improving rice stress tolerance:

  • Drought tolerance: Optimizing Casparian strip development through Os07g0692200 modification could enhance water retention during drought conditions.

  • Salinity tolerance: Modulating Os07g0692200 expression might improve exclusion of sodium ions at the root endodermis, enhancing salt tolerance.

  • Nutrient efficiency: Fine-tuning Os07g0692200 function could optimize nutrient uptake under variable soil conditions, particularly in low-nutrient environments.

  • Heavy metal tolerance: Enhancing barrier properties through Os07g0692200 regulation might reduce toxic metal uptake in contaminated soils.

Research approaches to investigate these possibilities include:

  • Creating rice lines with modulated Os07g0692200 expression

  • Testing these lines under various stress conditions

  • Measuring physiological parameters related to stress response

  • Analyzing nutrient content and distribution within the plant

What is the relationship between Os07g0692200 and root system architecture?

The relationship between Os07g0692200 and root system architecture represents an emerging area of research with implications for rice adaptation and productivity:

CASP proteins contribute to Casparian strip formation, which affects water and nutrient movement in the root. In rice, which has a more complex root structure than Arabidopsis , Os07g0692200 likely influences root development through:

  • Regulation of nutrient sensing: By controlling the movement of nutrient ions, Os07g0692200 may influence signaling pathways that regulate root growth and branching.

  • Hormonal crosstalk: Changes in water and nutrient status affected by Os07g0692200 function may alter hormone distribution and signaling, affecting root architecture.

  • Adaptation to soil conditions: The differential deposition of lignin and suberin in rice roots influenced by Os07g0692200 may represent adaptations to specific soil environments.

  • Interaction with other genetic factors: Os07g0692200 may interact with known regulators of root architecture, such as quantitative trait loci (QTLs) identified in genetic mapping studies .

Investigation of these relationships will require integrated approaches combining genetics, physiology, and developmental biology to unravel the complex interactions between Casparian strip formation and root system architecture.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.