Recombinant Oryza sativa subsp. japonica CASP-like protein Os08g0536200 (Os08g0536200, LOC_Os08g42430)

Shipped with Ice Packs
In Stock

Description

Molecular Characterization

The recombinant protein corresponds to the full-length CASP-like protein Os08g0536200 (LOC_Os08g42430), a 168-amino acid polypeptide with a molecular weight of ~17.5 kDa . Key features include:

PropertyDetail
Gene NameOs08g0536200 (synonyms: LOC_Os08g42430, OsCASPLUU-1)
Protein FamilyCASP-like protein (Casparian strip membrane domain protein family)
Expression SystemE. coli with N-terminal His tag
SequenceMVELESQEAVTVASTADIAVDVSLRLLAAATSLAAAVVVAANHQQRWGIRVDFTLFQVWI... (Full sequence in sources)
Purity>90% (SDS-PAGE)
StorageLyophilized powder in Tris/PBS buffer with 6% trehalose (pH 8.0)

Phylogenetic analysis places Os08g0536200 within the CASPL1A subgroup, sharing homology with Arabidopsis CASPL4C1 (At3g55390) . Collinearity studies suggest whole-genome duplication (WGD) and tandem duplication (TD) events drove CASP evolution in rice .

Role in Casparian Strip Formation

  • CASP proteins scaffold lignin deposition at endodermal cell walls by recruiting peroxidases, forming apoplastic barriers critical for nutrient transport and stress response .

  • Os08g0536200 is highly expressed in rice roots, particularly in endodermal cells, mirroring Arabidopsis CASP1-5 dynamics .

  • Mutational studies highlight its potential role in ion transport regulation: OsCASP_like2/3/13/17/21/30 variants show altered ion defect responses .

Stress Response

  • Cis-element analysis reveals MYB-binding motifs in its promoter region, linking it to abiotic stress adaptation .

  • Cold-induced CASPL homologs (e.g., ClCASPL in watermelon) modulate stress tolerance by altering lignin biosynthesis pathways .

Research Applications

ApplicationStudy DesignKey Findings
CS FormationRNA-seq and RT-qPCR in rice roots Os08g0536200 co-expressed with lignin biosynthesis genes.
Ion TransportMutant screening under salt stress OsCASP_like2/3/13/17/21/30 linked to ion homeostasis.
Protein-Protein InteractionYeast two-hybrid assays Direct interaction with peroxidases confirmed .
ELISA & ImmunoassaysCommercial kits (e.g., Creative BioMart, CD BioSciences) Used for quantitative analysis in plant tissue extracts.

Production & Quality Control

  • Expression: Optimized in E. coli for high yield (~0.1–1.0 mg/mL post-reconstitution) .

  • Purification: Affinity chromatography via His tag, followed by size-exclusion chromatography .

  • Stability: Lyophilized form retains activity for >12 months at -80°C; avoid repeated freeze-thaw cycles .

Evolutionary Context

  • CASPs evolved early in land plants, with rice containing 41 OsCASP genes compared to 39 in Arabidopsis .

  • Lineage-specific expansions in rice suggest adaptive roles in monocot-specific traits .

Technical Notes

  • Reconstitution: Use deionized water with 50% glycerol for long-term storage .

  • Activity Assays: Optimal performance in Tris-based buffers (pH 8.0) .

  • Safety: Not for human or clinical use .

Product Specs

Form
Lyophilized powder
Please note: We will prioritize shipping the format currently available in our inventory. However, if you have specific format requirements, kindly specify them in your order remarks, and we will prepare accordingly.
Lead Time
Delivery time may vary depending on the purchase method and location. Please contact your local distributors for specific delivery timeframes.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance as additional charges will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging this vial prior to opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%, which can be used as a reference.
Shelf Life
Shelf life is influenced by various factors such as storage conditions, buffer ingredients, temperature, and the intrinsic stability of the protein itself.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The shelf life of the lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt, and aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type will be determined during the production process. If you have specific tag type requirements, please inform us, and we will prioritize developing the specified tag.
Synonyms
Os08g0536200; LOC_Os08g42430; OSJNBa0033D24.32; P0665C04.13; CASP-like protein UU-1; OsCASPLUU-1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-168
Protein Length
full length protein
Species
Oryza sativa subsp. japonica (Rice)
Target Names
Os08g0536200
Target Protein Sequence
MVELESQEAVTVASTADIAVDVSLRLLAAATSLAAAVVVAANHQQRWGIRVDFTLFQVWI GFVAVNLVCTVYAAATAAAAARKAMGRWWLHHADAVVVNLEAAATAGAGAIGSIAMWGNE ASGWYAVCRLYRRYCNAGAAALALSLAAVLLLGVACARSRYPKMPPTT
Uniprot No.

Target Background

Database Links

KEGG: osa:4346161

Protein Families
Casparian strip membrane proteins (CASP) family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is the predicted structure and membrane topology of this protein?

Based on sequence analysis and comparison with other CASP family proteins, Os08g0536200 is predicted to be a membrane-spanning protein with multiple transmembrane domains. The protein contains several hydrophobic regions characteristic of membrane-integrated proteins, particularly the sequences "LAAATSLAAAVVVAANHQQR" and "GFVAVNLVCTVYAAATAAAAAR" which likely form transmembrane helices.

Structural predictions suggest this protein adopts a topology similar to other CASP family proteins, with 4 potential transmembrane domains and both N- and C-termini oriented toward the same side of the membrane. This arrangement is consistent with the protein's proposed function in the Casparian strip domain (CSD) of rice endodermal cells, where it may participate in the formation of a protein scaffold that guides lignin deposition .

How does this protein relate to other CASP family proteins?

This CASP-like protein is part of the broader CASP (Casparian strip membrane domain proteins) family, which includes OsCASP1 and other related proteins in rice. Phylogenetic analysis suggests that CASP proteins are evolutionarily conserved across plant species, with specific adaptations in monocots like rice.

The closest characterized relative is OsCASP1, which has been demonstrated to orchestrate Casparian strip formation and suberin deposition in rice roots . While OsCASP1 has been well-studied, the specific functions of Os08g0536200 remain to be fully elucidated. Research indicates that these proteins likely form oligomeric complexes that serve as scaffolds for lignin deposition during Casparian strip formation, similar to what has been observed in Arabidopsis CASP proteins .

What are optimal conditions for recombinant expression of CASP-like protein Os08g0536200?

For optimal recombinant expression of CASP-like protein Os08g0536200, the following protocol has proven effective:

Expression System:

  • Host: E. coli bacterial expression system (typically BL21(DE3) strain)

  • Vector: pET-based vector with N-terminal His-tag for purification

  • Induction: 0.5-1.0 mM IPTG at OD600 of 0.6-0.8

  • Temperature: Expression at 16-18°C overnight after induction (to minimize inclusion body formation)

  • Media: LB or 2XYT supplemented with appropriate antibiotics

Expression Optimization Tips:

  • Co-expression with molecular chaperones may improve solubility

  • Using Terrific Broth (TB) media can increase yield

  • Lowering IPTG concentration to 0.2mM might improve soluble fraction

  • Addition of 0.2% glucose can help reduce leaky expression

The resulting product is the full-length protein (residues 1-168) fused to an N-terminal His-tag, though other tagging strategies (MBP, GST) may be explored if solubility is an issue with membrane-associated proteins like this one .

What purification strategy yields the highest purity for functional studies?

A multi-step purification strategy is recommended for obtaining high-purity CASP-like protein Os08g0536200:

Step 1: Immobilized Metal Affinity Chromatography (IMAC)

  • Resuspend cell pellet in lysis buffer (typically Tris-based, pH 8.0)

  • Include protease inhibitors and mild detergents (0.1-0.5% Triton X-100 or DDM)

  • Purify using Ni-NTA or TALON resin

  • Wash with increasing imidazole concentrations (10-40 mM)

  • Elute with high imidazole (250-300 mM)

Step 2: Size Exclusion Chromatography (SEC)

  • Further purify IMAC fractions using Superdex 75 or 200 column

  • Buffer: Tris-based buffer (pH 8.0) with reduced detergent concentration

Step 3: Optional Ion Exchange Chromatography

  • For studies requiring extremely high purity

The purified protein should be stored in Tris-based buffer (pH 8.0) with 6% trehalose for stability . For long-term storage, adding glycerol to a final concentration of 50% and storing at -20°C/-80°C in small aliquots is recommended to avoid repeated freeze-thaw cycles .

How can researchers verify the structural integrity of purified protein?

To confirm the structural integrity and proper folding of purified CASP-like protein Os08g0536200, researchers should employ multiple complementary methods:

SDS-PAGE and Western Blotting:

  • Verifies protein size (expected ~19 kDa plus tag size)

  • Confirms protein purity (should exceed 90%)

  • Antibody detection confirms identity

Circular Dichroism (CD) Spectroscopy:

  • Provides information on secondary structure content

  • Allows monitoring of thermal stability

  • Can detect structural changes under different buffer conditions

Size Exclusion Chromatography with Multi-Angle Light Scattering (SEC-MALS):

  • Determines oligomeric state in solution

  • Confirms homogeneity of protein preparation

Functional Assays:

  • Binding studies with potential interaction partners

  • Reconstitution into liposomes to verify membrane integration

  • In vitro protein-protein interaction assays with other CASP family members

For quality control, lyophilized protein preparations should be reconstituted in deionized sterile water to a concentration of 0.1-1.0 mg/mL before performing these validation steps .

What methods can be used to study CASP-like protein Os08g0536200 localization in planta?

To investigate the subcellular localization of CASP-like protein Os08g0536200 in rice plants, researchers can utilize several complementary approaches:

Fluorescent Protein Fusion and Confocal Microscopy:

  • Create C- or N-terminal GFP/YFP fusions of Os08g0536200

  • Express in rice plants via Agrobacterium-mediated transformation

  • Visualize using confocal laser scanning microscopy

  • Co-localize with plasma membrane, cell wall, and endodermal markers

  • Use ClearSee solution treatment for whole-mount visualization of roots

Immunohistochemistry:

  • Generate specific antibodies against Os08g0536200

  • Perform immunolabeling on fixed rice root cross-sections

  • Use fluorescent secondary antibodies for detection

  • Include controls with known endodermal markers

Subcellular Fractionation and Western Blotting:

  • Isolate membrane fractions from rice roots

  • Perform Western blotting with anti-His antibodies (for recombinant tagged protein) or specific antibodies

  • Compare fractionation pattern with known membrane markers

For visualizing Casparian strip formation in relation to this protein, researchers should utilize the Basic Fuchsin and Calcofluor White staining method after ClearSee treatment, which has proven effective in rice secondary lateral roots (SLRs) . This approach allows for clear observation of Casparian strip structure and potential abnormalities in lignin deposition patterns.

How is CASP-like protein Os08g0536200 potentially involved in bacterial blight resistance?

The potential involvement of CASP-like protein Os08g0536200 in bacterial blight resistance represents an exciting research direction, particularly in light of recent findings on recessive bacterial blight resistance genes in rice:

Evidence for Involvement:

  • Mapping studies of the recessive bacterial blight resistance gene xa-45(t) from Oryza glaberrima identified a 80 Kb region containing 9 candidate genes on chromosome 8

  • Marker development and recombinant analysis revealed LOC_Os08g42410 as a candidate gene co-segregating with bacterial blight resistance

  • Expression analysis showed overexpression of LOC_Os08g42410-specific transcripts in resistant lines compared to susceptible ones following Xanthomonas oryzae pv. oryzae (Xoo) infection

  • The chromosomal location of Os08g0536200 (LOC_Os08g42430) places it in proximity to the mapped resistance locus

Experimental Approaches to Investigate This Connection:

  • Compare expression patterns of Os08g0536200 in resistant and susceptible rice lines before and after Xoo infection

  • Perform knockout/knockdown studies using CRISPR-Cas9 or RNAi targeting Os08g0536200

  • Develop transgenic rice lines overexpressing Os08g0536200 and assess bacterial blight resistance

  • Investigate potential protein-protein interactions between Os08g0536200 and known pathogen recognition or defense signaling components

The significant 4.46-fold increase in differential expression observed 72 hours after inoculation for the candidate gene LOC_Os08g42410 suggests these CASP-like proteins may play important roles in the rice immune response, potentially by reinforcing cell walls through altered lignification patterns in response to pathogen challenge.

What role might CASP-like protein Os08g0536200 play in Casparian strip formation?

Based on its sequence homology to OsCASP1 and other CASP proteins, Os08g0536200 likely plays a significant role in Casparian strip formation in rice roots:

Proposed Functions:

  • Scaffold Formation: Like other CASP proteins, Os08g0536200 may localize to the Casparian strip domain (CSD) and form oligomeric complexes that serve as a scaffold for lignin deposition

  • Regulation of Lignin Deposition: It may help direct the spatially restricted deposition of lignin in the endodermal cell walls

  • Interaction with Biosynthetic Enzymes: The protein likely interacts with peroxidases and other enzymes involved in lignin polymerization

  • Barrier Function Development: Contributes to the development of the apoplastic barrier that controls mineral nutrient uptake

Experimental Evidence from Related Proteins:
OsCASP1 has been shown to orchestrate Casparian strip formation in rice roots, with mutants displaying abnormal CS bands and delayed CS formation in secondary lateral roots . Whole-mount observation of SLRs after ClearSee solution treatment and staining with Basic Fuchsin and Calcofluor White revealed that most abnormal CSs displayed uneven lignin deposition .

To investigate Os08g0536200's specific role, researchers should compare wildtype and mutant/knockdown lines for:

  • Timing of Casparian strip formation

  • Pattern of lignin deposition

  • Integrity of the apoplastic barrier

  • Response to nutrient stress conditions

  • Expression patterns during root development stages

What protein-protein interaction methods are most suitable for studying CASP-like protein Os08g0536200?

Due to the membrane-integrated nature of CASP-like protein Os08g0536200, specialized approaches for studying protein-protein interactions are required:

Membrane-Specific Yeast Two-Hybrid Systems:

  • Split-ubiquitin yeast two-hybrid system specifically designed for membrane proteins

  • Screen against cDNA libraries from rice roots or endodermis-enriched tissues

  • Verify interactions with individual candidate proteins including other CASP family members

Co-Immunoprecipitation (Co-IP) from Plant Material:

  • Express epitope-tagged versions of Os08g0536200 in rice

  • Isolate membrane fractions using appropriate detergents

  • Perform immunoprecipitation under native conditions

  • Identify interacting partners via mass spectrometry

Bimolecular Fluorescence Complementation (BiFC):

  • Fuse split fluorescent protein fragments to Os08g0536200 and candidate interactors

  • Express in rice protoplasts or stable transgenic plants

  • Visualize reconstituted fluorescence at interaction sites in planta

  • Particularly useful for confirming interactions in the native cellular context

Proximity-Dependent Biotin Identification (BioID):

  • Fuse biotin ligase to Os08g0536200

  • Express in rice cells where proteins in close proximity become biotinylated

  • Purify biotinylated proteins and identify by mass spectrometry

  • Effectively captures transient interactions and spatial proximity in native conditions

Each method has specific advantages, and a combination approach is recommended for comprehensive mapping of the Os08g0536200 interactome, particularly focusing on interactions with other CASP family members and proteins involved in lignin biosynthesis and deposition.

How can CRISPR-Cas9 genome editing be optimized for studying Os08g0536200 function?

CRISPR-Cas9 genome editing provides powerful tools for functional characterization of Os08g0536200 in rice:

Optimal CRISPR Design Strategy:

  • gRNA Selection Criteria:

    • Target early exons to ensure complete loss-of-function

    • Design multiple gRNAs (3-4) targeting different regions of the gene

    • Avoid off-target sites by thorough bioinformatic analysis

    • Consider conserved domains for targeted functional disruption

  • Vector System Optimization:

    • Use rice-optimized codon versions of Cas9

    • Employ strong monocot promoters (e.g., Ubiquitin promoter)

    • Include visual selection markers (e.g., GFP) for transformation efficiency

  • Transformation Methods:

    • Agrobacterium-mediated transformation of rice calli

    • Particle bombardment as an alternative approach

    • Select Nipponbare or other transformation-amenable varieties

  • Advanced Editing Approaches:

    • Base editing for introducing specific amino acid changes

    • Prime editing for precise sequence modifications

    • Multiplex editing to target Os08g0536200 along with related CASP genes

  • Screening and Validation Protocol:

    • PCR-based genotyping followed by Sanger sequencing

    • T7 endonuclease I assay for mutation detection

    • Whole-genome sequencing to confirm absence of off-target effects

    • RT-qPCR to verify transcript disruption

For functional complementation studies, researchers should create rescue constructs with the wild-type Os08g0536200 gene to confirm phenotypes are specifically due to the targeted mutation rather than off-target effects .

What approaches can resolve contradictions in Os08g0536200 functional data?

When confronted with contradictory data regarding Os08g0536200 function, researchers should implement systematic investigation approaches:

Resolving Contradictory Expression Data:

  • Tissue-Specific RNA-Seq Analysis:

    • Conduct RNA-seq on isolated endodermal cells at multiple developmental stages

    • Compare expression in different root types (primary, lateral, crown roots)

    • Analyze expression under various stress conditions

  • Single-Cell Transcriptomics:

    • Apply single-cell RNA-seq to capture cell-type-specific expression patterns

    • Identify potential heterogeneity within endodermal cell populations

Addressing Functional Discrepancies:

  • Multiple Knockout Approaches:

    • Compare phenotypes from T-DNA insertion lines, CRISPR-Cas9 knockouts, and RNAi lines

    • Assess genetic background effects by introducing mutations into multiple varieties

    • Create allelic series with different mutation severities

  • Protein Localization Validation:

    • Use multiple tagging strategies (N-terminal vs. C-terminal)

    • Compare antibody-based detection with fluorescent protein fusions

    • Verify localization in different expression systems

  • Environmental Factor Analysis:

    • Systematically test phenotypes under varying nutrient conditions

    • Evaluate responses to different stress types (drought, salinity, pathogens)

    • Control for growth conditions that might affect phenotypic manifestation

  • Comparative Analysis with Related Genes:

    • Create double/triple mutants with related CASP genes

    • Assess functional redundancy through complementation tests

    • Compare phenotypes across different plant species

When testing for Casparian strip integrity, researchers should note that unlike in Arabidopsis, propidium iodide (PI) penetration testing in rice has limitations, as rice roots can hinder but not completely prevent PI entry into the stele . Therefore, multiple approaches should be combined to resolve potential contradictions in functional data.

What statistical approaches are recommended for analyzing Os08g0536200 expression data?

For robust analysis of Os08g0536200 expression data, researchers should implement the following statistical framework:

Differential Expression Analysis:

  • Time-Course Experiments:

    • Use specialized time-series analysis packages (e.g., maSigPro, STEM)

    • Apply repeated measures ANOVA with appropriate post-hoc tests

    • Include at least 6 time points (0, 8, 24, 48, 72, and 96 hours) when studying pathogen responses

  • Multi-Condition Comparisons:

    • Implement linear models with empirical Bayes statistics (limma package)

    • Control for false discovery rate using Benjamini-Hochberg procedure

    • Validate with at least 3 biological replicates and 2-3 technical replicates

Expression Data Visualization:

  • Create heat maps for temporal expression patterns

  • Use principal component analysis (PCA) to identify major sources of variation

  • Generate volcano plots to highlight significant expression changes

qRT-PCR Data Analysis:

  • Use multiple reference genes validated for stability in rice roots

  • Apply 2^(-ΔΔCT) method with efficiency correction

  • Conduct ANOVA followed by Tukey's HSD for multiple comparisons

  • Present fold-change data with appropriate error propagation

Based on previous studies, a significant differential expression threshold of 2-fold change is often used, with particular attention to the 72-hour timepoint which has shown a 4.46-fold increase in expression for related genes in bacterial blight resistance studies .

How can researchers design experiments to distinguish Os08g0536200 functions from other CASP proteins?

To delineate the specific functions of Os08g0536200 from other CASP family proteins in rice, researchers should implement a multi-faceted experimental design strategy:

Genetic Approach:

  • Create a Complete CASP Gene Family Mutant Collection:

    • Generate single, double, and higher-order mutants of all CASP genes

    • Perform comprehensive phenotypic analysis of each mutant combination

    • Identify unique phenotypes associated with Os08g0536200 disruption

  • Domain Swapping Experiments:

    • Create chimeric proteins exchanging domains between Os08g0536200 and other CASP proteins

    • Express in casp mutant backgrounds to assess functional complementation

    • Identify domains responsible for specific functions or localizations

Expression Pattern Analysis:

  • Tissue and Cell-Type Specificity:

    • Create promoter-reporter fusions for each CASP gene

    • Compare expression patterns in different root cell types and developmental stages

    • Identify unique spatiotemporal expression patterns of Os08g0536200

  • Stress-Responsive Expression:

    • Analyze expression changes under various biotic and abiotic stresses

    • Identify stress conditions specifically affecting Os08g0536200 vs. other CASP genes

Biochemical Characterization:

  • Protein-Protein Interaction Networks:

    • Compare interactomes of different CASP proteins

    • Identify unique interaction partners of Os08g0536200

    • Map protein complexes containing multiple CASP proteins

  • Post-Translational Modifications:

    • Analyze phosphorylation, ubiquitination, and other modifications

    • Identify regulatory mechanisms specific to Os08g0536200

This multi-layered approach will help distinguish the unique functions of Os08g0536200 from other CASP family members, particularly in relation to Casparian strip formation and potential roles in bacterial blight resistance.

What experimental controls are critical when studying Os08g0536200's role in bacterial blight resistance?

When investigating Os08g0536200's potential role in bacterial blight resistance, the following experimental controls are essential:

Genetic Controls:

  • Multiple Mutant Alleles:

    • Include at least 2-3 independent mutant lines targeting Os08g0536200

    • Use different mutation types (deletions, premature stop codons)

    • Include complementation lines expressing the wild-type gene

  • Genetic Background Controls:

    • Use appropriate near-isogenic lines with consistent genetic backgrounds

    • Include known susceptible (e.g., Pusa 44) and resistant (e.g., IL274) varieties as references

    • Use segregating populations to control for background effects

Pathogen Controls:

  • Multiple Xanthomonas Strains:

    • Test response to diverse Xoo strains with varying virulence

    • Include well-characterized pathogen isolates with known avirulence genes

    • Use tagged bacterial strains to track colonization patterns

  • Pathogen Dose Standardization:

    • Standardize inoculum concentration across experiments (typically 10^8-10^9 CFU/mL)

    • Include multiple inoculation methods (leaf clipping, infiltration)

    • Monitor bacterial growth curves in planta

Experimental Design Controls:

  • Time-Course Sampling:

    • Include multiple time points (0, 24, 48, 72, 96, and 120 hours post-inoculation)

    • Ensure consistent sampling techniques and tissue collection

    • Process all samples simultaneously to minimize batch effects

  • Environmental Standardization:

    • Maintain consistent growth conditions (temperature, humidity, light)

    • Include mock-inoculated plants at each time point

    • Consider seasonal effects on plant-pathogen interactions

  • Phenotypic Evaluation Standards:

    • Use multiple methods to assess disease (lesion length, bacterial counts, disease scoring)

    • Blind scoring to prevent observer bias

    • Include image analysis for objective quantification

Following these rigorous controls will help establish whether Os08g0536200 is genuinely involved in bacterial blight resistance, similar to the approach used in studies that identified LOC_Os08g42410 as a candidate gene for the xa-45(t) resistance gene .

What are the most promising research directions for Os08g0536200?

The CASP-like protein Os08g0536200 represents an important target for future research in rice biology, with several promising directions:

  • Detailed Functional Characterization:

    • Complete elucidation of its role in Casparian strip formation

    • Investigation of potential functions beyond the endodermis

    • Determination of its precise biochemical activities

  • Disease Resistance Applications:

    • Further exploration of its potential involvement in bacterial blight resistance

    • Investigation of roles in resistance to other pathogens

    • Development of molecular markers for breeding programs

  • Stress Adaptation Studies:

    • Analysis of Os08g0536200 functions under various abiotic stresses

    • Investigation of its role in nutrient uptake efficiency

    • Examination of regulatory mechanisms under changing environmental conditions

  • Comparative Studies Across Rice Varieties:

    • Analysis of allelic variation in diverse rice germplasm

    • Correlation of sequence polymorphisms with functional differences

    • Identification of superior alleles for crop improvement

  • Structural Biology Approaches:

    • Determination of high-resolution protein structure

    • Analysis of protein-protein interaction interfaces

    • Structure-guided protein engineering for enhanced function

These research directions will not only advance our understanding of this specific protein but also contribute to broader knowledge about Casparian strip formation, plant-pathogen interactions, and potential applications in rice improvement programs.

How can researchers integrate multi-omics approaches to study Os08g0536200?

An integrated multi-omics strategy would provide comprehensive insights into Os08g0536200 function:

Multi-Omics Integration Framework:

  • Genomics Foundation:

    • Whole-genome sequencing of multiple rice varieties

    • SNP analysis of Os08g0536200 across diverse germplasm

    • GWAS to connect Os08g0536200 variants with phenotypic traits

  • Transcriptomics Layer:

    • RNA-seq under multiple conditions and developmental stages

    • Alternative splicing analysis of Os08g0536200

    • Co-expression network analysis to identify functional modules

  • Proteomics Dimension:

    • Quantitative proteomics of wild-type vs. mutant plants

    • Phosphoproteomics to identify regulatory post-translational modifications

    • Interactomics to map protein-protein interaction networks

  • Metabolomics Insights:

    • Analysis of lignin composition in wild-type vs. mutant endodermis

    • Metabolite profiling during pathogen response

    • Spatial metabolomics to map metabolite distributions in roots

  • Phenomics Connection:

    • High-throughput phenotyping under various conditions

    • Root architecture analysis in 3D using advanced imaging

    • Field-based phenotyping for agronomic traits

Data Integration Methods:

  • Machine learning approaches to integrate multi-omics datasets

  • Network analysis to identify causal relationships

  • Systems biology modeling of Casparian strip formation and pathogen response

This integrated approach would provide unprecedented insights into the molecular mechanisms underlying Os08g0536200 function in both normal development and stress responses.

Protocol for Rice Root Clearing and Casparian Strip Visualization

For detailed visualization of Casparian strip formation in relation to CASP-like protein Os08g0536200, researchers should follow this optimized protocol:

Materials:

  • Rice seedlings (wild-type and os08g0536200 mutant lines)

  • ClearSee solution

  • Basic Fuchsin

  • Calcofluor White

  • Confocal microscope with appropriate filter sets

Procedure:

  • Sample Preparation:

    • Grow rice seedlings hydroponically in 1× Kimura B nutrient solution for 7-14 days

    • Harvest secondary lateral roots (SLRs) for optimal visualization

  • Tissue Clearing:

    • Fix roots in 4% paraformaldehyde (4 hours at room temperature)

    • Wash three times with PBS

    • Transfer samples to ClearSee solution

    • Incubate for 5-7 days, replacing solution every 2 days

  • Staining:

    • Add Basic Fuchsin (0.2% in ClearSee) to visualize lignified cell walls

    • Incubate for 1 hour at room temperature

    • Wash three times with fresh ClearSee

    • Counterstain with Calcofluor White (0.1% in ClearSee) for 30 minutes

    • Wash three times with ClearSee

  • Mounting and Imaging:

    • Mount cleared and stained roots in fresh ClearSee solution

    • Image using confocal microscopy (excitation/emission: Basic Fuchsin 488/500-550 nm; Calcofluor White 405/430-470 nm)

    • Capture Z-stacks to reconstruct 3D structure

  • Analysis:

    • Compare Casparian strip formation patterns between wild-type and mutant

    • Measure distance from root tip to first appearance of Casparian strip

    • Quantify frequency of abnormal Casparian strip structures

    • Document lignin deposition patterns

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.