Recombinant Oryza sativa subsp. japonica CASP-like protein Os11g0649400 (Os11g0649400, LOC_Os11g42940)

Shipped with Ice Packs
In Stock

Description

Primary Information

AttributeDetails
Gene NameOs11g0649400
SynonymsLOC_Os11g42940, OsCASPL1U1, Q2R0D4
UniProt IDQ2R0D4
Protein LengthFull-length (1–168 amino acids)
Molecular Weight~17,188 Da
Host SystemE. coli
TagN-terminal His-tag
Purity>90% (SDS-PAGE confirmed)

Amino Acid Sequence:
MDGAARAVSLFFRIAVVGLSVAAAVVMATASQAFPFNYGGAVSYTKYPAFVYFVVAAVVS AVCSAAALYLSVVREAAAGWAVALLDVVTMGLLFSAAGAVFAVRRMAPLYLGVAGADTVA GRWVNGEFCHAAGAFCWRVTTSAIICAFAAAAVSVAVLTKGARHRGKH .

Gene Family Overview

AttributeDetails
Family Size41 OsCASP genes in rice
Key SubgroupsGrouped into six clades based on phylogenetic analysis
Conserved MotifsMYB-binding cis-elements in promoters
Tissue ExpressionHighest in roots (endodermis) and small lateral root tips

Notable Members:

  • OsCASP_like11/9: High expression in endodermis, implicated in CS formation .

  • OsCASP_like2/3/13/17/21/30: Potential candidates for ion homeostasis under stress .

Comparative Evolutionary Analysis

CASP genes in rice and Arabidopsis show distinct evolutionary trajectories:

  • Whole Genome Duplications (WGDs): Dominant force in CASP gene expansion in rice .

  • Transmembrane Domains: Conserved basic/acidic residues in transmembrane helices (similar to MARVEL proteins) .

Future Directions

  • Mechanistic Studies: Elucidate Os11g0649400’s role in CS formation and suberin regulation.

  • Agricultural Applications: Engineer salt-tolerant rice varieties using CASP-like proteins .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and the protein's inherent stability.
Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during the production process. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
Os11g0649400; LOC_Os11g42940; OsJ_01636; CASP-like protein 1U1; OsCASPL1U1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-168
Protein Length
full length protein
Species
Oryza sativa subsp. japonica (Rice)
Target Names
Os11g0649400
Target Protein Sequence
MDGAARAVSLFFRIAVVGLSVAAAVVMATASQAFPFNYGGAVSYTKYPAFVYFVVAAVVS AVCSAAALYLSVVREAAAGWAVALLDVVTMGLLFSAAGAVFAVRRMAPLYLGVAGADTVA GRWVNGEFCHAAGAFCWRVTTSAIICAFAAAAVSVAVLTKGARHRGKH
Uniprot No.

Target Background

Database Links

UniGene: Os.95921

Protein Families
Casparian strip membrane proteins (CASP) family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is the function of CASP-like protein Os11g0649400 in rice root development?

CASP-like proteins in rice, including Os11g0649400, are implicated in the formation of Casparian strips in root endodermal cells. Unlike Arabidopsis, rice has a more complex root structure adapted to semi-aquatic growing conditions, with different deposition patterns of lignin and suberin that are crucial for adaptive responses .

Based on studies of related proteins like OsCASP1, CASP-like proteins likely form transmembrane scaffolds that recruit lignin biosynthetic enzymes for Casparian strip formation. They may also influence suberin deposition in the endodermis and sclerenchyma tissues, which affects nutrient uptake and ion balance in the plant . Researchers investigating Os11g0649400 should examine its expression patterns in different root tissues and under various environmental conditions to elucidate its specific role.

How does the structure of Os11g0649400 compare to other CASP family proteins?

Os11g0649400 belongs to the CASP family proteins in rice. While specific structural data for Os11g0649400 is limited in the provided search results, we can infer from related CASP proteins in rice. OsCASP1, for example, exhibits high sequence similarity with AtCASP1-4 from Arabidopsis .

To analyze the structural features of Os11g0649400:

  • Perform sequence alignment with other CASP proteins using tools like BLAST, Clustal Omega, or MUSCLE

  • Identify conserved domains characteristic of CASP family proteins

  • Conduct homology modeling to predict its 3D structure

  • Analyze transmembrane regions which are critical for scaffolding function

The recombinant His-tagged version of the protein can be used for structural studies including X-ray crystallography or cryo-electron microscopy to determine its precise 3D structure and compare it with other CASP family members.

What expression patterns does Os11g0649400 exhibit in different rice tissues?

Based on studies of related CASP proteins in rice, expression patterns likely vary across tissues and developmental stages. For OsCASP1, expression is:

  • Highly concentrated at the tips of small lateral roots (SLRs)

  • Strongly induced by salt stress in roots, particularly in the stele

  • Highly expressed in younger roots and SLRs

  • Moderately expressed in primary root tips

  • Weakly expressed in leaves

To determine the specific expression pattern of Os11g0649400:

  • Use RT-qPCR to quantify expression levels in different tissues

  • Develop promoter-GUS fusion constructs (similar to OsCASP1pro:OsCASP1-GUS) to visualize tissue-specific expression

  • Perform in situ hybridization to localize transcript accumulation

  • Use RNA-seq for genome-wide expression profiling under different conditions

A comparative expression table might look like this:

Tissue/ConditionExpression LevelDetection Method
SLR tipsSuspected highRT-qPCR
Primary rootTo be determinedRT-qPCR/Promoter-GUS
StelePotentially highIn situ hybridization
LeavesLikely lowRT-qPCR
Salt stressPotentially inducedRT-qPCR/RNA-seq

What methodologies are most effective for studying Os11g0649400 localization and function in rice roots?

Studying the localization and function of Os11g0649400 requires a multi-methodological approach:

Protein Localization:

  • Fluorescent protein fusion constructs (e.g., Os11g0649400-GFP) to visualize subcellular localization using confocal microscopy

  • Immunolocalization using specific antibodies against Os11g0649400

  • Tissue clearing techniques such as ClearSee combined with fluorescent staining can provide whole-mount visualization of protein localization in intact tissues

Note: When using immunostaining approaches, proper controls are essential. Previous studies with OsCASP1 demonstrated that autofluorescence of CSs can generate false positives. Always include negative controls (e.g., wild-type plants without tagged proteins) to distinguish between specific signals and autofluorescence .

Functional Analysis:

  • CRISPR/Cas9 gene editing to generate knockout mutants

  • RNAi to create knockdown lines

  • Complementation studies using the wild-type gene to rescue mutant phenotypes

  • Phenotypic analysis focusing on:

    • Root development

    • Casparian strip formation using Basic Fuchsin, berberine-aniline blue staining

    • Lignin and suberin deposition patterns

    • Salt stress tolerance

Interaction Studies:

  • Yeast two-hybrid screening to identify protein interaction partners

  • Co-immunoprecipitation (Co-IP) followed by mass spectrometry

  • Bimolecular fluorescence complementation (BiFC) to confirm protein-protein interactions in planta

How do mutations in Os11g0649400 affect Casparian strip formation and root barrier function?

To assess the impact of Os11g0649400 mutations on Casparian strip formation and barrier function:

Generating Mutant Lines:

  • CRISPR/Cas9 targeting exon regions of Os11g0649400 (similar to how OsCASP1-4 was generated)

  • Screening for homozygous mutants using PCR and sequencing

  • Complementation with wild-type Os11g0649400 to confirm phenotype causality

Analyzing CS Structure:

  • Basic Fuchsin and Calcofluor White staining combined with ClearSee solution for whole-mount observation of CS structure

  • Transmission electron microscopy (TEM) to observe detailed CS ultrastructure

  • Berberine-aniline blue staining to visualize CS and lignin deposition

  • Phloroglucinol staining for lignin deposition patterns

  • Fluorol Yellow 088 for suberin visualization

Barrier Function Assessment:

  • Propidium iodide (PI) penetration assays, though with caution as PI can penetrate somewhat into rice root steles even in wild-type plants

  • Transport assays using radioactive or fluorescently labeled nutrients

  • Apoplastic tracer dyes to assess barrier integrity

Based on OsCASP1 mutant studies, expected phenotypes might include:

  • Delayed CS formation in lateral roots

  • Uneven lignin deposition in endodermal cells

  • Altered suberin deposition patterns in the endodermis and sclerenchyma

  • Potential changes in nutrient uptake and ion balance

  • Reduced tolerance to salt stress

What is the relationship between Os11g0649400 and stress response mechanisms in rice?

To investigate the relationship between Os11g0649400 and stress responses:

Expression Analysis Under Stress:

  • RT-qPCR analysis of Os11g0649400 expression under various stresses (salt, drought, nutrient deficiency)

  • Promoter-GUS fusion analysis to visualize tissue-specific expression changes under stress

  • RNA-seq to identify co-regulated genes under stress conditions

Physiological Assessments:

  • Compare wild-type and mutant plants under stress conditions, measuring:

    • Growth parameters (root length, biomass)

    • Photosynthetic efficiency

    • Ion content (Na+, K+, Fe2+, etc.)

    • ROS accumulation

    • Stress hormone levels (ABA, ethylene)

Molecular Response Analysis:

  • Analyze expression of stress-responsive genes in mutant backgrounds

  • Investigate changes in the expression of genes involved in lignin and suberin biosynthesis

  • Examine potential transcription factor networks regulating Os11g0649400

Based on OsCASP1 studies, stress response involvement likely includes:

  • Upregulation under salt stress, particularly in root steles and sclerenchyma

  • Potential role in maintaining ion homeostasis under stress

  • Involvement in adaptive responses through modification of root barrier properties

How do different experimental conditions affect the stability and activity of recombinant Os11g0649400 protein?

For researchers working with recombinant Os11g0649400 protein:

Protein Purification Optimization:

  • Compare different expression systems (E. coli, yeast, insect cells)

  • Optimize purification protocols for His-tagged Os11g0649400

  • Test various buffer compositions for stability

  • Assess the effect of different detergents for membrane protein solubilization

Stability Assessment:

  • Thermal shift assays to determine protein thermal stability

  • Dynamic light scattering to monitor aggregation

  • Limited proteolysis to identify stable domains

  • Circular dichroism to assess secondary structure stability

Activity Assays:

  • Develop in vitro assays to measure:

    • Binding to interaction partners

    • Scaffold formation capability

    • Association with lipid membranes

Storage Conditions:

  • Test protein stability at different temperatures (-80°C, -20°C, 4°C)

  • Evaluate the effect of cryoprotectants and stabilizing agents

  • Assess the impact of freeze-thaw cycles on activity

How does Os11g0649400 interact with other proteins involved in Casparian strip formation?

To investigate protein-protein interactions:

Identification of Interaction Partners:

  • Yeast two-hybrid screening

  • Pull-down assays using His-tagged recombinant Os11g0649400

  • Co-immunoprecipitation followed by mass spectrometry

  • Protein microarrays

Validation of Interactions:

  • Bimolecular fluorescence complementation (BiFC)

  • Förster resonance energy transfer (FRET)

  • Surface plasmon resonance (SPR) or microscale thermophoresis (MST) for binding kinetics

  • Co-localization studies using confocal microscopy

Functional Significance:

  • Analyze phenotypes of double/triple mutants

  • Perform complementation studies with mutated interaction domains

  • Investigate changes in lignin deposition and CS formation when interactions are disrupted

Based on studies of OsCASP1, potential interaction partners may include:

  • Other CASP family proteins (for scaffold formation)

  • Lignin biosynthetic enzymes

  • Regulatory proteins such as OsMYB36a, OsMYB36b, and OsMYB36c, which can bind to the promoter of OsCASP1 and directly regulate its expression

How can contradictory results in Os11g0649400 research be reconciled?

When facing contradictory results in CASP protein research:

Methodological Reconciliation:

  • Carefully examine differences in experimental approaches

  • Consider the impact of different genetic backgrounds

  • Evaluate staining methods and their limitations for CS visualization

  • Assess the specificity of antibodies used in immunolocalization studies

Contextual Factors:

  • Growth conditions and developmental stages may significantly influence results

  • Rice variety differences could explain contradictory findings

  • Environmental stressors might alter expression patterns

For example, previous studies on OsCASP1 showed contradictory results regarding CS structure in primary roots. Some reported "broad CS" in mutants, while others could not reproduce these findings . Differences in:

  • Staining methods (Basic Fuchsin vs. berberine-aniline blue)

  • Precise position of cross-sections along the root

  • Genetic background of mutants

could explain these discrepancies. TEM analysis provided clearer evidence by visualizing CS structure that remains attached to the cell membrane after plasmolysis .

What are the most reliable markers and techniques for assessing Casparian strip integrity in Os11g0649400 studies?

Recommended Techniques:

TechniqueTargetAdvantagesLimitations
Basic Fuchsin + ClearSeeLigninWhole-mount visualization, high specificityComplex processing
Berberine-aniline blueCS structureGood contrastPotential background
TEMCS ultrastructureHighest resolution, definitiveLabor-intensive, limited tissue volume
Fluorol Yellow 088SuberinSpecific for suberin lamellaeLess sensitive than some methods
PhloroglucinolLigninSimple, fastLess specific than fluorescent methods

Important Considerations:

  • Propidium iodide (PI) penetration assays, while useful in Arabidopsis, have limitations in rice since PI can partially penetrate into rice root steles even in wild-type plants

  • Multiple complementary techniques should be used for conclusive results

  • Appropriate controls are essential (e.g., wild-type, known CS mutants)

  • Positional effects along the root axis must be considered, as CS formation varies with distance from the root tip

Developmental Timing:
The appearance time and structure of CS in rice roots differ from Arabidopsis, with CS formation in rice occurring earlier than in Arabidopsis . Thus, timing of observations is critical for accurate phenotyping.

How can gene expression data for Os11g0649400 be effectively normalized across different experimental conditions?

Reference Gene Selection:

  • Use multiple reference genes suited for specific experimental conditions

  • Validate stability of reference genes before normalization

  • For example, Fb15 (Fiber protein 15, Os02g0175800) was used as a reference gene in OsCASP1 studies

Normalization Strategies:

  • Apply geometric averaging of multiple reference genes

  • Consider using algorithms like geNorm, NormFinder, or BestKeeper to identify most stable references

  • Use global normalization methods for RNA-seq data

Cross-Platform Normalization:

  • When combining qPCR, microarray, and RNA-seq data, use:

    • Quantile normalization

    • Robust statistical methods (e.g., RUV – Remove Unwanted Variation)

    • Meta-analysis approaches

Reporting Guidelines:

  • Clearly document all normalization steps

  • Report raw and normalized values

  • Include reference gene validation data

  • Provide details on PCR efficiency and other quality controls

What emerging technologies could advance our understanding of Os11g0649400 function?

Advanced Imaging:

  • Super-resolution microscopy (STED, STORM, PALM) for nanoscale visualization of protein localization

  • Light sheet microscopy for 3D imaging of intact roots

  • Correlative light and electron microscopy (CLEM) to connect protein localization with ultrastructure

Genetic Engineering:

  • Optogenetic tools to control Os11g0649400 activity in specific cells/tissues

  • Genome editing beyond knockouts:

    • Base editing for specific amino acid changes

    • Prime editing for precise modifications

    • CRISPR activation/interference for modulating expression levels

Single-Cell Technologies:

  • Single-cell RNA-seq to map expression in specific cell types

  • Single-cell proteomics to analyze protein levels

  • Spatial transcriptomics to maintain tissue context information

Structural Biology:

  • Cryo-electron microscopy to visualize protein complexes

  • Integrative structural biology combining X-ray crystallography, NMR, and computational modeling

  • AlphaFold and similar AI tools for structure prediction

How might comparative studies across rice varieties enhance our understanding of Os11g0649400 evolution and adaptation?

Evolutionary Analysis:

  • Compare Os11g0649400 sequences across diverse rice varieties (japonica, indica, aus, etc.)

  • Analyze selection signatures and conservation patterns

  • Relate sequence polymorphisms to environmental adaptations

Functional Diversity:

  • Assess Os11g0649400 expression patterns in rice varieties adapted to different environments

  • Evaluate CS formation and suberin deposition across varieties

  • Use CRISPR/Cas9 to swap alleles between varieties

Methodology:

  • Create a diversity panel of Os11g0649400 alleles

  • Use genome-wide association studies (GWAS) to link natural variation to phenotypes

  • Perform ecogeographic surveys correlating allele frequency with environmental factors

  • Conduct transformation experiments to test complementation across varieties

What are the considerations for designing multi-generational studies on Os11g0649400 function in rice?

Experimental Design:

  • Establish stable homozygous mutant and transgenic lines

  • Maintain appropriate wild-type controls from the same genetic background

  • Include multiple rice varieties to assess background effects

  • Design for both controlled environment and field studies

Phenotyping Strategy:

  • Develop high-throughput, non-destructive phenotyping protocols

  • Monitor root development and architecture across generations

  • Assess yield components and stress resilience

  • Track nutrient uptake efficiency under various conditions

Environmental Variables:

  • Test performance under multiple stress conditions:

    • Salt stress (most relevant based on OsCASP1 studies)

    • Drought stress

    • Nutrient limitation

  • Include climate change relevant variables (elevated CO₂, temperature fluctuations)

Transgenerational Effects:

  • Monitor for potential epigenetic changes affecting Os11g0649400 expression

  • Assess stability of phenotypes across generations

  • Consider seed storage effects on subsequent generations

What are the optimal conditions for expressing and purifying recombinant Os11g0649400 protein?

Based on related membrane protein studies and the available recombinant His-tagged Os11g0649400 :

Expression Systems:

  • E. coli: BL21(DE3) or C41/C43(DE3) strains optimized for membrane proteins

  • Yeast (P. pastoris or S. cerevisiae) for eukaryotic post-translational modifications

  • Insect cell systems for complex proteins

Expression Optimization:

  • Test multiple induction conditions:

    • IPTG concentration (0.1-1.0 mM)

    • Induction temperature (16-30°C)

    • Induction duration (4-24 hours)

  • Consider fusion tags beyond His-tag:

    • MBP or GST for solubility enhancement

    • SUMO tag for improved folding

Purification Strategy:

  • Two-step purification:

    • Initial IMAC (immobilized metal affinity chromatography) using the His-tag

    • Secondary purification by size exclusion or ion exchange chromatography

  • Detergent selection for membrane protein:

    • Mild detergents (DDM, LMNG) for initial extraction

    • Consider detergent exchange during purification

Quality Control:

  • SDS-PAGE and Western blotting to confirm purity

  • Mass spectrometry for identity confirmation

  • Dynamic light scattering for homogeneity assessment

  • Circular dichroism to verify secondary structure

How can researchers effectively design primers for Os11g0649400 cloning and expression analysis?

Primer Design Guidelines:

  • For RT-qPCR:

    • Design primers spanning exon-exon junctions to avoid genomic DNA amplification

    • Keep amplicon size between 80-150 bp

    • Aim for 50-60% GC content

    • Check for potential secondary structures and primer dimers

  • For Cloning:

    • Include appropriate restriction sites with 3-6 nucleotide overhangs

    • Consider codon optimization for the expression system

    • For Gibson Assembly or In-Fusion cloning, include 15-20 bp overlaps

  • For CRISPR/Cas9 targeting:

    • Select target sites with minimal off-target potential

    • Verify PAM sequences appropriate for the Cas variant being used

    • Design guide RNAs targeting early exons

Example Primers for Os11g0649400:

ApplicationForward Primer (5'-3')Reverse Primer (5'-3')Notes
RT-qPCRGACCTCGTCAACATCCTCGTCAGTAGCGTGACCTTGACGAAmplicon ~120 bp
Cloning (full CDS)CACCATGXXXXXXXXXXXXXXXTCAXXXXXXXXXXXXXXXXXStart codon to stop codon
Promoter cloningXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX~1-2 kb upstream of TSS

Reference Gene Primers:
When performing expression analysis, use validated reference genes such as Fb15 (Os02g0175800) , Ubiquitin, or Actin depending on the experimental conditions.

What approaches can overcome challenges in phenotyping subtle root development differences in Os11g0649400 mutants?

Advanced Imaging Approaches:

  • High-throughput root phenotyping systems:

    • Rhizotrons for non-destructive root architecture analysis

    • Transparent growth media (agar, hydrogel) for continuous monitoring

  • Automated image analysis:

    • Machine learning algorithms for root feature extraction

    • Software packages like RootNav, GiA Roots, or EZ-Rhizo

Molecular Phenotyping:

  • Transcriptome analysis to identify altered gene expression patterns

  • Metabolomic profiling to detect changes in root metabolites

  • Ionomic analysis to measure mineral content changes

Cellular-Level Analysis:

  • Enhanced staining protocols:

    • Combine ClearSee with fluorescent stains for whole-mount visualization

    • Use multiple stains in sequence (Basic Fuchsin + Calcofluor White)

  • Quantitative measurements:

    • Cell-by-cell analysis of lignin/suberin deposition

    • Precise timing of CS formation along the root axis

Functional Assays:

  • Radioactive tracer studies to measure nutrient uptake

  • Time-course analysis of CS formation using clearing techniques

  • Hydraulic conductivity measurements

  • Stress response assays (salt, drought tolerance)

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.