| Attribute | Details |
|---|---|
| Gene Name | Os11g0649400 |
| Synonyms | LOC_Os11g42940, OsCASPL1U1, Q2R0D4 |
| UniProt ID | Q2R0D4 |
| Protein Length | Full-length (1–168 amino acids) |
| Molecular Weight | ~17,188 Da |
| Host System | E. coli |
| Tag | N-terminal His-tag |
| Purity | >90% (SDS-PAGE confirmed) |
Amino Acid Sequence:
MDGAARAVSLFFRIAVVGLSVAAAVVMATASQAFPFNYGGAVSYTKYPAFVYFVVAAVVS AVCSAAALYLSVVREAAAGWAVALLDVVTMGLLFSAAGAVFAVRRMAPLYLGVAGADTVA GRWVNGEFCHAAGAFCWRVTTSAIICAFAAAAVSVAVLTKGARHRGKH .
OsCASP_like11/9: High expression in endodermis, implicated in CS formation .
OsCASP_like2/3/13/17/21/30: Potential candidates for ion homeostasis under stress .
CASP genes in rice and Arabidopsis show distinct evolutionary trajectories:
Whole Genome Duplications (WGDs): Dominant force in CASP gene expansion in rice .
Transmembrane Domains: Conserved basic/acidic residues in transmembrane helices (similar to MARVEL proteins) .
UniGene: Os.95921
CASP-like proteins in rice, including Os11g0649400, are implicated in the formation of Casparian strips in root endodermal cells. Unlike Arabidopsis, rice has a more complex root structure adapted to semi-aquatic growing conditions, with different deposition patterns of lignin and suberin that are crucial for adaptive responses .
Based on studies of related proteins like OsCASP1, CASP-like proteins likely form transmembrane scaffolds that recruit lignin biosynthetic enzymes for Casparian strip formation. They may also influence suberin deposition in the endodermis and sclerenchyma tissues, which affects nutrient uptake and ion balance in the plant . Researchers investigating Os11g0649400 should examine its expression patterns in different root tissues and under various environmental conditions to elucidate its specific role.
Os11g0649400 belongs to the CASP family proteins in rice. While specific structural data for Os11g0649400 is limited in the provided search results, we can infer from related CASP proteins in rice. OsCASP1, for example, exhibits high sequence similarity with AtCASP1-4 from Arabidopsis .
To analyze the structural features of Os11g0649400:
Perform sequence alignment with other CASP proteins using tools like BLAST, Clustal Omega, or MUSCLE
Identify conserved domains characteristic of CASP family proteins
Conduct homology modeling to predict its 3D structure
Analyze transmembrane regions which are critical for scaffolding function
The recombinant His-tagged version of the protein can be used for structural studies including X-ray crystallography or cryo-electron microscopy to determine its precise 3D structure and compare it with other CASP family members.
Based on studies of related CASP proteins in rice, expression patterns likely vary across tissues and developmental stages. For OsCASP1, expression is:
Highly concentrated at the tips of small lateral roots (SLRs)
Strongly induced by salt stress in roots, particularly in the stele
Highly expressed in younger roots and SLRs
Moderately expressed in primary root tips
To determine the specific expression pattern of Os11g0649400:
Use RT-qPCR to quantify expression levels in different tissues
Develop promoter-GUS fusion constructs (similar to OsCASP1pro:OsCASP1-GUS) to visualize tissue-specific expression
Perform in situ hybridization to localize transcript accumulation
Use RNA-seq for genome-wide expression profiling under different conditions
A comparative expression table might look like this:
| Tissue/Condition | Expression Level | Detection Method |
|---|---|---|
| SLR tips | Suspected high | RT-qPCR |
| Primary root | To be determined | RT-qPCR/Promoter-GUS |
| Stele | Potentially high | In situ hybridization |
| Leaves | Likely low | RT-qPCR |
| Salt stress | Potentially induced | RT-qPCR/RNA-seq |
Studying the localization and function of Os11g0649400 requires a multi-methodological approach:
Protein Localization:
Fluorescent protein fusion constructs (e.g., Os11g0649400-GFP) to visualize subcellular localization using confocal microscopy
Immunolocalization using specific antibodies against Os11g0649400
Tissue clearing techniques such as ClearSee combined with fluorescent staining can provide whole-mount visualization of protein localization in intact tissues
Note: When using immunostaining approaches, proper controls are essential. Previous studies with OsCASP1 demonstrated that autofluorescence of CSs can generate false positives. Always include negative controls (e.g., wild-type plants without tagged proteins) to distinguish between specific signals and autofluorescence .
Functional Analysis:
CRISPR/Cas9 gene editing to generate knockout mutants
RNAi to create knockdown lines
Complementation studies using the wild-type gene to rescue mutant phenotypes
Phenotypic analysis focusing on:
Root development
Casparian strip formation using Basic Fuchsin, berberine-aniline blue staining
Lignin and suberin deposition patterns
Salt stress tolerance
Interaction Studies:
Yeast two-hybrid screening to identify protein interaction partners
Co-immunoprecipitation (Co-IP) followed by mass spectrometry
Bimolecular fluorescence complementation (BiFC) to confirm protein-protein interactions in planta
To assess the impact of Os11g0649400 mutations on Casparian strip formation and barrier function:
Generating Mutant Lines:
CRISPR/Cas9 targeting exon regions of Os11g0649400 (similar to how OsCASP1-4 was generated)
Screening for homozygous mutants using PCR and sequencing
Complementation with wild-type Os11g0649400 to confirm phenotype causality
Analyzing CS Structure:
Basic Fuchsin and Calcofluor White staining combined with ClearSee solution for whole-mount observation of CS structure
Transmission electron microscopy (TEM) to observe detailed CS ultrastructure
Berberine-aniline blue staining to visualize CS and lignin deposition
Phloroglucinol staining for lignin deposition patterns
Fluorol Yellow 088 for suberin visualization
Barrier Function Assessment:
Propidium iodide (PI) penetration assays, though with caution as PI can penetrate somewhat into rice root steles even in wild-type plants
Transport assays using radioactive or fluorescently labeled nutrients
Apoplastic tracer dyes to assess barrier integrity
Based on OsCASP1 mutant studies, expected phenotypes might include:
Delayed CS formation in lateral roots
Uneven lignin deposition in endodermal cells
Altered suberin deposition patterns in the endodermis and sclerenchyma
Potential changes in nutrient uptake and ion balance
To investigate the relationship between Os11g0649400 and stress responses:
Expression Analysis Under Stress:
RT-qPCR analysis of Os11g0649400 expression under various stresses (salt, drought, nutrient deficiency)
Promoter-GUS fusion analysis to visualize tissue-specific expression changes under stress
RNA-seq to identify co-regulated genes under stress conditions
Physiological Assessments:
Compare wild-type and mutant plants under stress conditions, measuring:
Growth parameters (root length, biomass)
Photosynthetic efficiency
Ion content (Na+, K+, Fe2+, etc.)
ROS accumulation
Stress hormone levels (ABA, ethylene)
Molecular Response Analysis:
Analyze expression of stress-responsive genes in mutant backgrounds
Investigate changes in the expression of genes involved in lignin and suberin biosynthesis
Examine potential transcription factor networks regulating Os11g0649400
Based on OsCASP1 studies, stress response involvement likely includes:
Upregulation under salt stress, particularly in root steles and sclerenchyma
Potential role in maintaining ion homeostasis under stress
Involvement in adaptive responses through modification of root barrier properties
For researchers working with recombinant Os11g0649400 protein:
Protein Purification Optimization:
Compare different expression systems (E. coli, yeast, insect cells)
Test various buffer compositions for stability
Assess the effect of different detergents for membrane protein solubilization
Stability Assessment:
Thermal shift assays to determine protein thermal stability
Dynamic light scattering to monitor aggregation
Limited proteolysis to identify stable domains
Circular dichroism to assess secondary structure stability
Activity Assays:
Develop in vitro assays to measure:
Binding to interaction partners
Scaffold formation capability
Association with lipid membranes
Storage Conditions:
Test protein stability at different temperatures (-80°C, -20°C, 4°C)
Evaluate the effect of cryoprotectants and stabilizing agents
Assess the impact of freeze-thaw cycles on activity
To investigate protein-protein interactions:
Identification of Interaction Partners:
Yeast two-hybrid screening
Co-immunoprecipitation followed by mass spectrometry
Protein microarrays
Validation of Interactions:
Bimolecular fluorescence complementation (BiFC)
Förster resonance energy transfer (FRET)
Surface plasmon resonance (SPR) or microscale thermophoresis (MST) for binding kinetics
Co-localization studies using confocal microscopy
Functional Significance:
Analyze phenotypes of double/triple mutants
Perform complementation studies with mutated interaction domains
Investigate changes in lignin deposition and CS formation when interactions are disrupted
Based on studies of OsCASP1, potential interaction partners may include:
Other CASP family proteins (for scaffold formation)
Lignin biosynthetic enzymes
Regulatory proteins such as OsMYB36a, OsMYB36b, and OsMYB36c, which can bind to the promoter of OsCASP1 and directly regulate its expression
When facing contradictory results in CASP protein research:
Methodological Reconciliation:
Carefully examine differences in experimental approaches
Consider the impact of different genetic backgrounds
Evaluate staining methods and their limitations for CS visualization
Assess the specificity of antibodies used in immunolocalization studies
Contextual Factors:
Growth conditions and developmental stages may significantly influence results
Rice variety differences could explain contradictory findings
Environmental stressors might alter expression patterns
For example, previous studies on OsCASP1 showed contradictory results regarding CS structure in primary roots. Some reported "broad CS" in mutants, while others could not reproduce these findings . Differences in:
Staining methods (Basic Fuchsin vs. berberine-aniline blue)
Precise position of cross-sections along the root
Genetic background of mutants
could explain these discrepancies. TEM analysis provided clearer evidence by visualizing CS structure that remains attached to the cell membrane after plasmolysis .
Recommended Techniques:
| Technique | Target | Advantages | Limitations |
|---|---|---|---|
| Basic Fuchsin + ClearSee | Lignin | Whole-mount visualization, high specificity | Complex processing |
| Berberine-aniline blue | CS structure | Good contrast | Potential background |
| TEM | CS ultrastructure | Highest resolution, definitive | Labor-intensive, limited tissue volume |
| Fluorol Yellow 088 | Suberin | Specific for suberin lamellae | Less sensitive than some methods |
| Phloroglucinol | Lignin | Simple, fast | Less specific than fluorescent methods |
Important Considerations:
Propidium iodide (PI) penetration assays, while useful in Arabidopsis, have limitations in rice since PI can partially penetrate into rice root steles even in wild-type plants
Multiple complementary techniques should be used for conclusive results
Appropriate controls are essential (e.g., wild-type, known CS mutants)
Positional effects along the root axis must be considered, as CS formation varies with distance from the root tip
Developmental Timing:
The appearance time and structure of CS in rice roots differ from Arabidopsis, with CS formation in rice occurring earlier than in Arabidopsis . Thus, timing of observations is critical for accurate phenotyping.
Reference Gene Selection:
Use multiple reference genes suited for specific experimental conditions
Validate stability of reference genes before normalization
For example, Fb15 (Fiber protein 15, Os02g0175800) was used as a reference gene in OsCASP1 studies
Normalization Strategies:
Apply geometric averaging of multiple reference genes
Consider using algorithms like geNorm, NormFinder, or BestKeeper to identify most stable references
Use global normalization methods for RNA-seq data
Cross-Platform Normalization:
When combining qPCR, microarray, and RNA-seq data, use:
Quantile normalization
Robust statistical methods (e.g., RUV – Remove Unwanted Variation)
Meta-analysis approaches
Reporting Guidelines:
Clearly document all normalization steps
Report raw and normalized values
Include reference gene validation data
Provide details on PCR efficiency and other quality controls
Advanced Imaging:
Super-resolution microscopy (STED, STORM, PALM) for nanoscale visualization of protein localization
Light sheet microscopy for 3D imaging of intact roots
Correlative light and electron microscopy (CLEM) to connect protein localization with ultrastructure
Genetic Engineering:
Optogenetic tools to control Os11g0649400 activity in specific cells/tissues
Genome editing beyond knockouts:
Base editing for specific amino acid changes
Prime editing for precise modifications
CRISPR activation/interference for modulating expression levels
Single-Cell Technologies:
Single-cell RNA-seq to map expression in specific cell types
Single-cell proteomics to analyze protein levels
Spatial transcriptomics to maintain tissue context information
Structural Biology:
Cryo-electron microscopy to visualize protein complexes
Integrative structural biology combining X-ray crystallography, NMR, and computational modeling
AlphaFold and similar AI tools for structure prediction
Evolutionary Analysis:
Compare Os11g0649400 sequences across diverse rice varieties (japonica, indica, aus, etc.)
Analyze selection signatures and conservation patterns
Relate sequence polymorphisms to environmental adaptations
Functional Diversity:
Assess Os11g0649400 expression patterns in rice varieties adapted to different environments
Evaluate CS formation and suberin deposition across varieties
Use CRISPR/Cas9 to swap alleles between varieties
Methodology:
Create a diversity panel of Os11g0649400 alleles
Use genome-wide association studies (GWAS) to link natural variation to phenotypes
Perform ecogeographic surveys correlating allele frequency with environmental factors
Conduct transformation experiments to test complementation across varieties
Experimental Design:
Establish stable homozygous mutant and transgenic lines
Maintain appropriate wild-type controls from the same genetic background
Include multiple rice varieties to assess background effects
Design for both controlled environment and field studies
Phenotyping Strategy:
Develop high-throughput, non-destructive phenotyping protocols
Monitor root development and architecture across generations
Assess yield components and stress resilience
Track nutrient uptake efficiency under various conditions
Environmental Variables:
Test performance under multiple stress conditions:
Include climate change relevant variables (elevated CO₂, temperature fluctuations)
Transgenerational Effects:
Monitor for potential epigenetic changes affecting Os11g0649400 expression
Assess stability of phenotypes across generations
Consider seed storage effects on subsequent generations
Based on related membrane protein studies and the available recombinant His-tagged Os11g0649400 :
Expression Systems:
E. coli: BL21(DE3) or C41/C43(DE3) strains optimized for membrane proteins
Yeast (P. pastoris or S. cerevisiae) for eukaryotic post-translational modifications
Insect cell systems for complex proteins
Expression Optimization:
Test multiple induction conditions:
IPTG concentration (0.1-1.0 mM)
Induction temperature (16-30°C)
Induction duration (4-24 hours)
Consider fusion tags beyond His-tag:
MBP or GST for solubility enhancement
SUMO tag for improved folding
Purification Strategy:
Two-step purification:
Initial IMAC (immobilized metal affinity chromatography) using the His-tag
Secondary purification by size exclusion or ion exchange chromatography
Detergent selection for membrane protein:
Mild detergents (DDM, LMNG) for initial extraction
Consider detergent exchange during purification
Quality Control:
SDS-PAGE and Western blotting to confirm purity
Mass spectrometry for identity confirmation
Dynamic light scattering for homogeneity assessment
Circular dichroism to verify secondary structure
Primer Design Guidelines:
For RT-qPCR:
Design primers spanning exon-exon junctions to avoid genomic DNA amplification
Keep amplicon size between 80-150 bp
Aim for 50-60% GC content
Check for potential secondary structures and primer dimers
For Cloning:
For CRISPR/Cas9 targeting:
Select target sites with minimal off-target potential
Verify PAM sequences appropriate for the Cas variant being used
Design guide RNAs targeting early exons
Example Primers for Os11g0649400:
| Application | Forward Primer (5'-3') | Reverse Primer (5'-3') | Notes |
|---|---|---|---|
| RT-qPCR | GACCTCGTCAACATCCTCGT | CAGTAGCGTGACCTTGACGA | Amplicon ~120 bp |
| Cloning (full CDS) | CACCATGXXXXXXXXXXXXXXX | TCAXXXXXXXXXXXXXXXXX | Start codon to stop codon |
| Promoter cloning | XXXXXXXXXXXXXXXXXX | XXXXXXXXXXXXXXXXXX | ~1-2 kb upstream of TSS |
Reference Gene Primers:
When performing expression analysis, use validated reference genes such as Fb15 (Os02g0175800) , Ubiquitin, or Actin depending on the experimental conditions.
Advanced Imaging Approaches:
High-throughput root phenotyping systems:
Rhizotrons for non-destructive root architecture analysis
Transparent growth media (agar, hydrogel) for continuous monitoring
Automated image analysis:
Machine learning algorithms for root feature extraction
Software packages like RootNav, GiA Roots, or EZ-Rhizo
Molecular Phenotyping:
Transcriptome analysis to identify altered gene expression patterns
Metabolomic profiling to detect changes in root metabolites
Ionomic analysis to measure mineral content changes
Cellular-Level Analysis:
Enhanced staining protocols:
Quantitative measurements:
Cell-by-cell analysis of lignin/suberin deposition
Precise timing of CS formation along the root axis
Functional Assays:
Radioactive tracer studies to measure nutrient uptake
Time-course analysis of CS formation using clearing techniques
Hydraulic conductivity measurements
Stress response assays (salt, drought tolerance)