Recombinant Oryza sativa subsp. japonica CASP-like protein Os11g0649600 (Os11g0649600, LOC_Os11g42960)

Shipped with Ice Packs
In Stock

Description

Recombinant Oryza sativa subsp. japonica CASP-like protein Os11g0649600: Structure, Function, and Applications

Recombinant Oryza sativa subsp. japonica CASP-like protein Os11g0649600 is a member of the Casparian Strip Membrane Domain Protein (CASP) family, essential for proper endodermal barrier formation in rice roots. This 204-amino acid protein (UniProt ID: Q2R0D2) plays a crucial role in establishing selective permeability barriers in plant roots, facilitating controlled nutrient and water uptake. Recent research has identified this protein as a potential candidate for improving stress tolerance in rice plants, with significant expression in root endodermal tissues where it contributes to Casparian strip formation through its membrane scaffolding and cell wall modification functions.

Background and Significance

CASP-like proteins represent a significant family of plant membrane proteins that are pivotal for the formation of Casparian strips in endodermal cells and play crucial roles in a plant's response to environmental stresses . The Casparian strip is a specialized cell wall modification that creates an apoplastic diffusion barrier in the endodermis of plant roots, controlling the selective uptake of water and nutrients while protecting against harmful substances .

The CASP-like protein Os11g0649600 (LOC_Os11g42960) is specifically from the subspecies japonica of rice (Oryza sativa), a staple crop crucial for global food security. This protein belongs to a larger family of CASP and CASP-like proteins that have been identified across various plant species. In rice alone, researchers have identified 41 OsCASP genes, which have been grouped into six distinct subgroups based on their structural and functional characteristics .

Evolutionary Context

Recent comprehensive bioinformatics analyses have shed light on the evolutionary history of CASP genes in rice and Arabidopsis. Collinearity analysis has underscored the pivotal roles of whole genome duplication (WGD) and tandem duplication (TD) events in driving the evolution of CASPs, with WGDs being the dominant force . This evolutionary pattern suggests that CASP proteins have undergone significant specialization and functional diversification throughout plant evolutionary history, contributing to their varied roles in different plant tissues and developmental stages.

Gene and Protein Information

The Os11g0649600 gene encodes a CASP-like protein with several recognized synonyms in various databases and literature. The protein is formally classified as a member of the CASP superfamily with specific characteristics detailed in Table 1.

Table 1: Gene and Protein Information for Os11g0649600

CharacteristicInformation
Gene NameOs11g0649600
Locus IDLOC_Os11g42960
SynonymsOsJ_01638, CASP-like protein 1U3, OsCASPL1U3
UniProt IDQ2R0D2
Protein Length204 amino acids
Molecular FamilyCasparian Strip Membrane Domain Protein (CASP)
Subgroup ClassificationCASPL1 family

The gene encoding this protein is located on chromosome 11 of the rice genome and has been consistently identified in genomic analyses of rice CASP family members . The recombinant form of this protein is typically expressed with an N-terminal histidine tag to facilitate purification and experimental applications .

Casparian Strip Formation

CASP proteins, including Os11g0649600, are fundamentally involved in the formation of Casparian strips, which are crucial barrier structures in the endodermis of plant roots. These proteins act as scaffolds that spatially organize cell wall biosynthetic enzymes, determining the subcellular localization of other proteins involved in the lignification process . The role of CASPs is to assemble specific NADPH oxidases with peroxidases, leading to oxidation of mono-lignols and local polymerization of lignin to form the Casparian strip .

Mutant studies in model plants have demonstrated that disruptions in CASP function lead to abnormal Casparian strip formation, which compromises the selective permeability barrier of the endodermis. This often results in plants attempting to compensate through enhanced deposition of suberin lamellae, indicating the critical nature of these proteins for proper root function .

Membrane Domain Organization

One of the most remarkable functions of CASP proteins is their ability to form stable membrane domains. Studies have shown that these proteins are initially targeted to the whole plasma membrane but are quickly removed from lateral plasma membranes to become exclusively localized at the Casparian strip membrane domain (CSD), where they show extremely low turnover .

At the CSD, CASP proteins create a membrane diffusion barrier that restricts the movement of other membrane proteins and lipids. This barrier function is critical for maintaining the polarity of the endodermal cell, with different transporters and channels being restricted to either the inner or outer lateral membranes . This precise organization of membrane domains is essential for the directional transport of nutrients and water in plant roots.

Expression Patterns

RNA sequencing analyses have revealed that the majority of OsCASP genes, including Os11g0649600, are highly expressed in roots, particularly in endodermal cells . This tissue-specific expression pattern aligns with their functional role in Casparian strip formation and endodermal barrier establishment.

In comparative studies between rice and Arabidopsis, specific OsCASP genes (including OsCASP_like11 and OsCASP_like9) showed particularly pronounced expression in endodermal cells, suggesting their critical involvement in the formation of the endodermis Casparian strip . Additionally, quantitative PCR analyses have identified several OsCASP genes, including OsCASP_like2, OsCASP_like3, OsCASP_like13, OsCASP_like17, OsCASP_like21, and OsCASP_like30, as potential candidates involved in ion defect processes, highlighting their importance in nutrient homeostasis .

Expression and Purification

The recombinant form of Os11g0649600 protein is typically produced in Escherichia coli expression systems with an N-terminal histidine tag to facilitate purification . This approach allows for the production of sufficient quantities of the protein for structural and functional studies. The technical specifications for the recombinant protein production are summarized in Table 2.

Functional Genomics

The recombinant Os11g0649600 protein serves as a valuable tool for functional genomics studies aimed at understanding the molecular mechanisms of Casparian strip formation and endodermal barrier function in rice. By investigating the interactions and activities of this protein in vitro and in vivo, researchers can gain insights into its specific roles in cellular processes and plant development.

Comparative analyses with other CASP family members can illuminate evolutionary relationships and functional divergence within this protein family. The availability of high-quality recombinant protein enables structural studies, protein-protein interaction analyses, and biochemical assays that can reveal the molecular basis of CASP function in plant cells.

Agricultural Applications

Understanding the function of Os11g0649600 and other CASP family proteins has significant implications for agricultural applications, particularly in developing rice varieties with enhanced stress tolerance. The regulation of water and nutrient uptake through modulation of endodermal barrier properties could potentially improve plant performance under various environmental stresses, including drought, salinity, and nutrient deficiency.

Recent findings suggest that OsCASP genes may be involved in ion defect processes, indicating their potential role in nutrient use efficiency . This knowledge could be leveraged to develop rice varieties with improved nutrient uptake capabilities, reducing the need for fertilizer inputs and enhancing sustainable agricultural practices.

Comparative Biology

The study of Os11g0649600 in rice provides valuable comparative data when considered alongside CASP research in other plant species, particularly the model plant Arabidopsis thaliana. Cross-species comparisons can reveal conserved mechanisms of endodermal barrier formation and specialization, as well as species-specific adaptations that may reflect different environmental challenges or growth strategies.

Recent bioinformatics analyses have identified 41 OsCASP genes in rice compared to 39 AtCASP genes in Arabidopsis, grouped into six distinct subgroups . This comparative approach has provided insights into the evolutionary history of the CASP gene family and the functional significance of different family members.

Functional Characterization

Further characterization of Os11g0649600 function in rice plants through genetic approaches, including gene editing, RNA interference, or overexpression studies, would provide valuable insights into its specific roles in endodermal barrier formation and plant stress responses. Analysis of phenotypes resulting from altered expression of this gene could reveal its importance for root development, nutrient uptake, and tolerance to various environmental stresses.

Additionally, investigation of protein-protein interactions involving Os11g0649600 would illuminate its role in molecular complexes that regulate Casparian strip formation and maintenance. Identification of interaction partners could reveal novel components of the endodermal barrier formation machinery and potential targets for crop improvement.

Product Specs

Form
Lyophilized powder
Please note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, kindly indicate them during order placement, and we will accommodate your request.
Lead Time
Delivery time may vary based on the purchasing method or location. For specific delivery timelines, we recommend consulting your local distributors.
Please note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. We suggest storing working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial prior to opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. To enhance long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting the solution at -20°C/-80°C. Our default final glycerol concentration is 50%, which you can use as a reference.
Shelf Life
The shelf life is influenced by various factors such as storage conditions, buffer ingredients, storage temperature, and the inherent stability of the protein.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. Lyophilized form typically has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. For multiple use, aliquoting is essential. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during the production process. If you have a specific tag type preference, please inform us, and we will prioritize developing the specified tag.
Synonyms
Os11g0649600; LOC_Os11g42960; OsJ_01638; CASP-like protein 1U3; OsCASPL1U3
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-204
Protein Length
full length protein
Species
Oryza sativa subsp. japonica (Rice)
Target Names
Os11g0649600
Target Protein Sequence
MCEGEKKKDSSSGALYCVNLALRIVVLGLAVAAAALMATASQCTIFLYYGGPLHTITYKD FGPFVYLVVASSIGAFMEAIAIFLTICKKKDGTPAKVLLPLLDAAVPVLLYSATAAAFAA GDMSYCAVGKRVGVCTTAAAGNFCNQVHIAMYVSLAAGVALLVAEIVKHWPDSGKKKEGG GGGCGSDSDSDKSTPCHHGCHSKH
Uniprot No.

Target Background

Database Links

KEGG: osa:4351033

UniGene: Os.12421

Protein Families
Casparian strip membrane proteins (CASP) family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

How does OsCASP-like protein Os11g0649600 relate to other members of the CASP family in rice?

OsCASP-like protein Os11g0649600 is one of 41 identified OsCASP genes in rice, which collectively form six distinct phylogenetic subgroups based on comprehensive bioinformatics analysis . The evolutionary relationships among these proteins are primarily driven by whole genome duplication (WGD) and tandem duplication (TD) events, with WGDs being the dominant force in their diversification .

Within this family, OsCASP1 (which is distinct from but related to Os11g0649600) has been well-characterized functionally. Most OsCASP and AtCASP (Arabidopsis thaliana) genes contain MYB binding motifs in their promoter regions, suggesting conserved transcriptional regulation mechanisms across species . Notably, expression analysis using RNA-seq data indicates that OsCASP_like11 and OsCASP_like9 show particularly high expression in endodermal cells, making them candidate genes for endodermal Casparian strip formation . When designing experiments to study specific CASP proteins, it's essential to consider potential functional redundancy among family members and to verify specificity of any genetic interventions or detection methods.

What is the expression pattern of OsCASP-like protein Os11g0649600 in rice tissues?

RNA-sequencing analysis reveals that most OsCASP genes, including Os11g0649600, demonstrate high expression primarily in root tissues, with particular enrichment in endodermal cells . This tissue-specific expression pattern aligns with their proposed function in Casparian strip formation. The expression of OsCASP genes begins in the root elongation zone, which coincides with the developmental timing of Casparian strip formation .

When studying expression patterns experimentally, it's recommended to use techniques such as quantitative RT-PCR with tissue-specific sampling or in situ hybridization to accurately capture the spatial distribution of expression. Additionally, promoter-reporter constructs (such as pOsCASP:GUS or pOsCASP:GFP) can provide valuable visual information about the expression domains. For protein localization studies, immunohistochemistry or fluorescent protein fusion approaches can reveal the subcellular localization pattern, which typically shows progression from uniform plasma membrane distribution to concentrated localization at the Casparian strip domain in mature endodermal cells .

How does OsCASP1 contribute to Casparian strip formation in rice compared to Arabidopsis models?

OsCASP1, while distinct from Os11g0649600, provides important insights into CASP protein function in rice that may inform research on related proteins like Os11g0649600. The formation of Casparian strips in rice differs significantly from Arabidopsis, reflecting rice's adaptation to semi-aquatic environments . In rice, OsCASP1 initially localizes to all sides of the plasma membrane in endodermal cells without Casparian strips, then concentrates to the middle of the anticlinal side of endodermal cells with developing Casparian strips . This dynamic relocalization is critical for proper Casparian strip formation.

The knockout of OsCASP1 results in defective Casparian strip formation at the endodermis, leading to decreased growth under both soil and hydroponic conditions . This phenotype demonstrates the essential role of CASP proteins in maintaining proper barrier function in the root endodermis. Unlike Arabidopsis, rice roots have a more complex radial structure, including epidermis, exodermis, sclerenchyma, midcortex, endodermis, and stele from outside inward . This structural complexity likely requires specialized functions of CASP proteins that aren't present in Arabidopsis.

When designing comparative studies between rice and Arabidopsis CASP proteins, researchers should account for these anatomical differences and employ appropriate microscopy techniques (such as lignin/suberin-specific staining methods) to accurately assess Casparian strip formation between species. Transmission electron microscopy remains the gold standard for ultrastructural analysis of Casparian strips, while fluorescent dye penetration assays can assess functional barrier integrity.

What molecular mechanisms underlie OsCASP function in mineral nutrient homeostasis?

The Casparian strip formed by CASP proteins functions as a crucial apoplastic barrier that regulates selective mineral uptake in plants. Knockout studies of OsCASP1 reveal significant alterations in mineral composition, with mutants accumulating more calcium but less manganese, zinc, iron, cadmium, and arsenic in shoots compared to wild-type plants . This differential impact on various minerals suggests that CASP proteins contribute to element-specific transport regulation mechanisms.

The molecular basis for this selectivity likely involves interactions between CASP proteins and specific transporters. For instance, the disruption of OsCASP1 affects the abundance (but not localization) of the silicon transporter Low Si 1 at the distal side of the endodermis, resulting in substantially reduced silicon uptake . Similarly, calcium accumulation in oscasp1 mutants is exacerbated under high calcium conditions, suggesting that the Casparian strip is particularly important for restricting calcium uptake .

To investigate these molecular mechanisms, researchers should consider:

  • Protein-protein interaction studies (co-immunoprecipitation, yeast two-hybrid, or BiFC) to identify binding partners

  • Transporter activity assays in the presence and absence of functional CASP proteins

  • Isotope tracer experiments to track specific mineral movement in wild-type versus mutant backgrounds

  • Electrophysiological approaches to measure ion fluxes across endodermal membranes

How do environmental stresses modulate OsCASP gene expression and function?

CASP proteins play crucial roles in plant responses to environmental stresses, particularly those affecting mineral nutrition and water relations. RT-qPCR analyses indicate that several OsCASP genes, including OsCASP_like2, OsCASP_like3, OsCASP_like13, OsCASP_like17, OsCASP_like21, and OsCASP_like30, may be candidate genes involved in ion deficiency responses . The presence of stress-responsive cis-elements in the promoter regions of many OsCASP genes, particularly MYB binding motifs, provides a potential mechanism for stress-responsive expression .

The adaptation of rice to its growth conditions involves specialized deposition patterns of lignin and suberin in root tissues, which are critically influenced by CASP protein function . Under stress conditions, these barrier properties may be modified to optimize nutrient acquisition while maintaining protective functions.

When designing experiments to investigate stress responses:

  • Use carefully controlled stress treatments (ionic imbalances, drought, salinity, etc.)

  • Monitor both transcriptional responses (qRT-PCR, RNA-seq) and post-translational modifications

  • Assess changes in Casparian strip structure and composition under stress conditions

  • Compare responses between wild-type and CASP-deficient plants to identify CASP-dependent stress adaptations

  • Consider tissue-specific and developmental stage-specific responses, as these may vary significantly

What are the optimal conditions for recombinant expression and purification of Os11g0649600?

For efficient expression and purification of recombinant Os11g0649600, the following methodology is recommended based on established protocols:

Expression System:

  • Host: E. coli (typically BL21(DE3) or Rosetta strains)

  • Vector: pET-series vectors with N-terminal His-tag fusion

  • Induction: IPTG (0.5-1.0 mM) at OD₆₀₀ of 0.6-0.8

  • Temperature: Reduce to 16-20°C after induction to enhance proper folding

  • Duration: 16-18 hours post-induction for optimal yield

Purification Strategy:

  • Cell lysis: Sonication in Tris/PBS-based buffer (pH 8.0) containing protease inhibitors

  • Affinity chromatography: Ni-NTA resin with imidazole gradient elution

  • Size exclusion chromatography: To achieve >90% purity as verified by SDS-PAGE

  • Final formulation: Tris/PBS-based buffer with 6% trehalose at pH 8.0

Storage Recommendations:

  • Lyophilize the purified protein for long-term stability

  • For working aliquots, store at -20°C/-80°C with 50% glycerol to prevent freeze-thaw degradation

  • Working solutions can be maintained at 4°C for up to one week

Reconstitution Protocol:

  • Briefly centrifuge vials before opening

  • Reconstitute in deionized sterile water to 0.1-1.0 mg/mL

  • Add glycerol to 5-50% final concentration for aliquots intended for long-term storage

This methodology optimizes protein yield while maintaining structural integrity, ensuring proper folding and functionality for downstream applications.

How can researchers effectively study CASP protein localization and dynamics in plant tissues?

Studying CASP protein localization and dynamics requires specialized techniques due to the complex architecture of plant roots and the precise subcellular targeting of these proteins. The following methodological approaches are recommended:

Tissue Preparation:

  • Use vibratome sectioning of fresh root material for live-cell imaging

  • Alternatively, employ classical histological techniques with fixation for immunolabeling

Protein Localization Techniques:

  • Fluorescent protein fusions (C-terminal fusions may preserve functionality better than N-terminal)

  • Immunohistochemistry with specific antibodies against the target CASP protein

  • Correlative light and electron microscopy for ultrastructural localization

Dynamic Studies:

  • Fluorescence Recovery After Photobleaching (FRAP) to assess membrane mobility

  • Photoactivatable or photoconvertible fluorescent protein fusions to track protein movement

  • Time-lapse imaging during development or stress responses

Co-localization Analysis:

  • Multi-channel confocal microscopy with established membrane or Casparian strip markers

  • Super-resolution microscopy (STED, STORM, or SIM) for detailed spatial organization

  • BiFC or split-GFP approaches to visualize protein-protein interactions in situ

Based on published studies, CASP proteins typically show developmental progression from uniform plasma membrane distribution to concentrated localization at the Casparian strip domain . This dynamic relocalization is critical for proper Casparian strip formation and should be carefully documented through developmental time-course experiments.

What techniques are most effective for functional characterization of CASP proteins in rice?

Functional characterization of CASP proteins in rice requires a multi-faceted approach combining genetic, physiological, and biochemical techniques. The following methodological framework is recommended:

Genetic Approaches:

  • CRISPR/Cas9-mediated knockout of target CASP genes

  • RNAi or antisense-mediated knockdown for partial loss-of-function

  • Overexpression studies using constitutive or tissue-specific promoters

  • Complementation assays with wild-type or mutated versions of the target gene

Physiological Characterization:

  • Root hydraulic conductivity measurements

  • Apoplastic tracer studies using fluorescent dyes (e.g., propidium iodide) or radiotracers

  • Mineral content analysis via ICP-MS or ICP-OES for multiple elements

  • Growth assays under various nutrient regimes or stress conditions

Biochemical Approaches:

  • Protein complex isolation via co-immunoprecipitation

  • Membrane protein topology mapping

  • Post-translational modification analysis

  • Protein-protein interaction studies using yeast two-hybrid or pull-down assays

Structural Analyses:

  • Casparian strip integrity assessment using autofluorescence or specific stains

  • Suberin and lignin composition analysis

  • Transmission electron microscopy for ultrastructural characterization

  • Atomic force microscopy for nanomechanical properties

Studies of OsCASP1 demonstrate the power of combining these approaches, revealing both structural defects in Casparian strip formation and functional consequences for mineral transport when the gene is disrupted . Notably, knockout of OsCASP1 affected mineral composition, with mutants accumulating more calcium but less manganese, zinc, iron, cadmium, and arsenic in shoots compared to wild-type plants .

How should researchers interpret mineral content changes in CASP-deficient rice plants?

The interpretation of mineral content alterations in CASP-deficient plants requires careful consideration of direct and indirect effects. Based on studies of OsCASP1 mutants, researchers should consider the following analytical framework:

Direct vs. Indirect Effects:
When analyzing mineral content data, distinguish between:

  • Direct effects resulting from compromised Casparian strip integrity

  • Indirect effects from compensatory mechanisms or physiological adaptations

  • Secondary effects from altered growth or development

Element-Specific Considerations:
Different elements show distinct patterns in CASP mutants. For example, OsCASP1 knockout results in:

  • Increased calcium accumulation in shoots

  • Decreased manganese, zinc, iron, cadmium, and arsenic levels

  • Substantially reduced silicon uptake

These differential effects suggest element-specific transport regulation mechanisms that may involve interactions between CASP proteins and specific transporters.

Contextual Factors:
When interpreting mineral data, consider:

  • Growth conditions (soil vs. hydroponic)

  • Developmental stage at sampling

  • Tissue-specific accumulation patterns

  • Environmental factors that may influence mineral availability

Statistical Analysis:

  • Employ ANOVA with appropriate post-hoc tests for multi-element comparisons

  • Consider multivariate approaches (PCA, clustering) to identify element correlation patterns

  • Normalize to appropriate reference points (e.g., dry weight, protein content)

The distinctive pattern of increased calcium but decreased micronutrients in OsCASP1 mutants suggests that the Casparian strip differentially regulates the movement of these elements, potentially through separate transport pathways or barrier properties .

What are the key considerations when analyzing CASP gene expression data across different tissues and conditions?

Analysis of CASP gene expression data requires careful attention to tissue specificity, developmental timing, and environmental influences. Based on research findings, consider the following analytical framework:

Tissue-Specific Expression:

  • Most OsCASP genes show highest expression in roots, particularly in endodermal cells

  • Expression patterns may differ between primary roots and lateral roots

  • Expression domains should be correlated with Casparian strip formation zones

Developmental Timing:

  • CASP expression typically begins in the root elongation zone

  • Expression patterns change during root development and maturation

  • Temporal expression profiles should be analyzed in relation to Casparian strip development stages

Conditional Responses:

  • Several OsCASP genes respond to ion deficiency stress

  • Expression may be modulated by environmental conditions relevant to barrier function

  • Analysis should include appropriate time points after stress application

Data Normalization and Reference Genes:

  • Use multiple reference genes validated for stability under the specific conditions

  • Consider tissue-specific reference genes for cross-tissue comparisons

  • Normalize to cell-type-specific markers when using heterogeneous tissue samples

Statistical Approaches:

  • Apply appropriate statistical methods for time-series data

  • Use clustering approaches to identify co-regulated CASP genes

  • Consider gene regulatory network analysis to identify upstream regulators

Research has shown that OsCASP_like11 and OsCASP_like9 are particularly highly expressed in endodermal cells, making them prime candidates for endodermal Casparian strip formation . Similarly, OsCASP_like2, OsCASP_like3, OsCASP_like13, OsCASP_like17, OsCASP_like21, and OsCASP_like30 show responses to ion deficiency conditions, suggesting specialized roles in stress adaptation .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.