Recombinant Oryza sativa subsp. japonica Casparian strip membrane protein Os02g0743900 (Os02g0743900, LOC_Os02g51010)

Shipped with Ice Packs
In Stock

Description

General Overview of CASP Proteins

Casparian strip membrane proteins (CASPs) constitute a specialized family of proteins that are fundamental to plant development and survival through their role in establishing diffusion barriers in root tissues. These proteins form a scaffold in the plasma membrane that recruits the lignin polymerization machinery, enabling the formation of the Casparian strip, a ring-like structure composed of lignin and other aromatic compounds that encircles endodermal cells . The CASP family in rice includes at least 41 OsCASP genes that have been identified through comprehensive bioinformatics analysis, with these genes being categorized into six distinct subgroups based on their structural and functional characteristics . Evolutionary analysis has revealed that whole genome duplication (WGD) and tandem duplication (TD) events have been pivotal in driving the evolution of CASPs, with WGD being identified as the dominant force in this evolutionary process . The conservation of CASP proteins across diverse plant species underscores their biological significance in regulating selective nutrient uptake and maintaining cellular integrity under various environmental conditions.

Importance in Plant Development and Stress Response

CASP proteins play a critical role in establishing diffusion barriers that regulate the movement of water, nutrients, and potential toxins in the plant root system. The formation of the Casparian strip in the endodermis creates an apoplastic barrier that forces substances to pass through the selective filter of the cell membrane, thereby allowing plants to control the uptake of essential minerals while excluding harmful elements . Research has demonstrated that disruption of CASP protein function leads to significant alterations in mineral element distribution within plant tissues, highlighting their importance in maintaining proper nutrient balance . Expression analysis through RNA-seq has revealed that most OsCASP genes exhibit high expression levels in root tissues, particularly in endodermal cells where the Casparian strip is formed, with OsCASP_like11 and OsCASP_like9 showing the most pronounced expression among the family members . Additionally, some CASP genes, including OsCASP_like2, OsCASP_like3, OsCASP_like13, OsCASP_like17, OsCASP_like21, and OsCASP_like30, have been identified as candidate genes involved in the plant's response to ion deficiency conditions, further emphasizing their importance in stress adaptation mechanisms .

Amino Acid Sequence and Domain Organization

The Os02g0743900 protein consists of 201 amino acids with a specific sequence that determines its structural and functional properties. The full amino acid sequence is: "MEGKAAVTTSTEHGDGEASRTAARTVVSGSSRGGAASRALSVADLILRVVAVVAIVDSAIAMGTTNQTLPFFTQFLRFKAQYSDLPTLTLFVVANSAVTAYLVLSIPLSVVHIIRSRASYSRLVLIFLDSVILALVAAVASA SAAIVYLAHKGNVRANWFAVCQQFDSFCERISGPLIGSFAAMAVLLLLVLLSAAALARR" . Analysis of the protein sequence reveals characteristic domains that are essential for its localization and function within the plant cell. The protein contains a signal peptide that directs it to the plasma membrane, where it becomes integrated as an integral membrane protein with multiple transmembrane regions . Additionally, the protein features domains that facilitate interaction with cell wall components and other proteins involved in Casparian strip formation, which are critical for its role in establishing the CSD and facilitating CS deposition .

Role in Casparian Strip Formation

Os02g0743900 plays a crucial role in the formation of the Casparian strip in rice endodermal cells through its specific localization and interaction with other proteins. Studies have shown that the protein initially localizes to all sides of the plasma membrane in endodermal cells without CS, before becoming concentrated at the middle of the anticlinal side of endodermal cells where the CS is formed . This precise localization pattern is essential for establishing the Casparian strip membrane domain (CSD), which serves as a platform for the deposition of lignin and other components that form the Casparian strip barrier . Research has demonstrated that knockout of CASP genes in rice results in defective CS formation at the endodermis, leading to compromised barrier function and altered mineral uptake . The protein interacts with other components of the CSD complex, including enzymes involved in lignin biosynthesis and cell wall modification, to coordinate the formation of a continuous ring-like structure that seals the apoplastic space between adjacent endodermal cells .

Impact on Nutrient Homeostasis

The role of Os02g0743900 in Casparian strip formation has significant implications for nutrient homeostasis in rice plants. Studies on CASP gene knockouts in rice have revealed that disruption of CS formation leads to altered mineral element distribution, with mutant plants accumulating more calcium but less manganese, zinc, iron, cadmium, and arsenic in their shoots compared to wild-type plants . These changes in mineral distribution highlight the importance of the Casparian strip as a selective barrier that regulates the movement of elements between the soil solution and the vascular tissues of the plant . Additionally, research has shown that defects in CS formation can exacerbate growth inhibition under conditions of high calcium concentration in the growth medium, indicating the critical role of this barrier in maintaining proper ion balance under varying environmental conditions . The influence of Os02g0743900 on nutrient homeostasis extends to silicon uptake as well, with evidence suggesting that CS integrity affects the abundance of silicon transporters such as Low Silicon 1 (Lsi1) in the endodermis, resulting in reduced silicon accumulation in plants with compromised CS formation .

Table 2: Effects of CASP Protein Dysfunction on Mineral Element Distribution in Rice

Mineral ElementChange in Shoot Concentration in CASP MutantsPhysiological Implication
Calcium (Ca)IncreasedPotential disruption of signaling and cell wall integrity
Manganese (Mn)DecreasedCompromised photosynthesis and oxidative stress response
Zinc (Zn)DecreasedReduced enzyme function and protein synthesis
Iron (Fe)DecreasedImpaired chlorophyll synthesis and electron transport
Cadmium (Cd)DecreasedAltered toxic metal exclusion capabilities
Arsenic (As)DecreasedChanged toxic metalloid management
Silicon (Si)Substantially reducedCompromised structural integrity and stress resistance

Expression Systems and Purification

The recombinant production of Os02g0743900 involves advanced expression systems and purification techniques that yield high-quality protein for research applications. The protein is typically expressed in Escherichia coli as a host organism, with genetic constructs designed to include specific tags that facilitate purification and detection . Common expression vectors incorporate a His-tag fusion, which enables efficient purification through affinity chromatography using metal chelating resins . The recombinant protein production process typically begins with the cloning of the Os02g0743900 gene into a suitable expression vector, followed by transformation into a bacterial host strain optimized for protein expression . After induction of protein expression, the cells are harvested and lysed, and the recombinant protein is purified through a series of chromatographic steps to obtain a product with high purity and biological activity . The purified protein is typically formulated in a Tris-based buffer containing 50% glycerol, which has been optimized to maintain protein stability during storage .

Relevance to Plant Biology Research

The study of Os02g0743900 and related CASP proteins has significantly advanced our understanding of plant development and barrier formation mechanisms. Research on these proteins has provided crucial insights into the molecular basis of the Casparian strip, a structure that has been known for more than one hundred years but whose molecular composition remained poorly understood until recently . The identification and characterization of CASP proteins have revealed the sophisticated machinery that plants employ to establish selective barriers in their roots, highlighting the evolutionary adaptations that enable them to thrive in diverse environments . Studies utilizing recombinant CASP proteins have facilitated investigations into protein-protein interactions, helping to elucidate the complex network of molecular interactions that coordinate the formation of the Casparian strip and regulate its barrier function . Additionally, research on Os02g0743900 has contributed to our understanding of the specialized cell biology of the endodermis, revealing mechanisms of polar protein localization and the establishment of distinct plasma membrane domains that are essential for plant tissue function .

Agricultural Implications and Future Directions

The functional characterization of Os02g0743900 and its role in nutrient homeostasis has significant implications for agriculture, particularly in the context of crop improvement strategies. Understanding the molecular mechanisms that regulate nutrient uptake and distribution in plants provides a foundation for developing crops with enhanced nutrient use efficiency, which could reduce fertilizer requirements and associated environmental impacts . Research has demonstrated that CASP proteins influence the uptake and distribution of essential minerals as well as potentially toxic elements, suggesting that modulation of Casparian strip properties could be leveraged to enhance crop nutrition or limit the accumulation of contaminants in edible plant parts . Future research directions include the development of crop varieties with optimized Casparian strip characteristics, which could improve plant performance under conditions of nutrient limitation or excess . Additionally, ongoing investigations aim to elucidate the regulatory mechanisms that control CASP gene expression in response to environmental stresses, which could provide new strategies for enhancing crop resilience in the face of climate change and other agricultural challenges .

Table 4: Research Applications and Potential Agricultural Benefits of Os02g0743900 Studies

Research FocusApplicationsPotential Agricultural Benefits
Protein structure-function analysisUnderstanding molecular basis of CS formationRational design of crops with modified barrier properties
Gene expression regulationIdentifying stress response mechanismsDevelopment of stress-tolerant varieties
Protein-protein interactionsMapping the Casparian strip interactomeEnhanced control of nutrient uptake processes
Mutant phenotype analysisCorrelating CS structure with nutrient distributionImproved nutrient use efficiency in crops
Comparative studies across speciesEvolutionary insights into barrier formationTransferring beneficial traits between crop species
Silicon uptake mechanismsUnderstanding Si transport regulationDevelopment of crops with enhanced silicon utilization

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
Os02g0743900; LOC_Os02g51010; OJ1734_E02.23; Casparian strip membrane protein 4; OsCASP4
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-201
Protein Length
full length protein
Species
Oryza sativa subsp. japonica (Rice)
Target Names
Os02g0743900
Target Protein Sequence
MEGKAAVTTSTEHGDGEASRTAARTVVSGSSRGGAASRALSVADLILRVVAVVAIVDSAI AMGTTNQTLPFFTQFLRFKAQYSDLPTLTLFVVANSAVTAYLVLSIPLSVVHIIRSRASY SRLVLIFLDSVMLALVAAVASASAAIVYLAHKGNVRANWFAVCQQFDSFCERISGPLIGS FAAMAVLLLLVLLSAAALARR
Uniprot No.

Target Background

Function

Function: Recombinant Oryza sativa subsp. japonica Casparian strip membrane protein Os02g0743900 (Os02g0743900, LOC_Os02g51010) regulates membrane-cell wall junctions and localized cell wall deposition. It is essential for establishing the Casparian strip membrane domain (CSD) and subsequent Casparian strip formation. The Casparian strip, a cell wall modification in the root endodermis, acts as an apoplastic barrier between the intraorganismal and extraorganismal apoplasm, preventing lateral diffusion.

Database Links
Protein Families
Casparian strip membrane proteins (CASP) family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is the structural characterization of Os02g0743900 protein?

Os02g0743900 is a four-transmembrane protein that belongs to the Casparian strip membrane protein (CASP) family. It has a full length of 201 amino acids and contains the characteristic DUF588 domain . Like other CASPs, it likely forms a stable membrane scaffold with low turnover rates when localized to specific membrane domains . The protein contains extracellular loops that, while not essential for generating the membrane scaffold, may play important roles in protein-protein interactions and cell wall modification processes . The transmembrane domains contain highly conserved residues that are likely involved in proper localization and formation of membrane domains .

What are the known functions of Os02g0743900 in rice?

Os02g0743900 functions as a Casparian strip membrane protein involved in the formation of Casparian strips in rice roots. These proteins mediate the deposition of lignin in the cell wall by recruiting the lignin polymerization machinery . They play dual roles: (1) forming membrane scaffolds that create diffusion barriers in the plasma membrane, and (2) directing local cell wall modifications through interactions with secreted peroxidases to facilitate lignin deposition . Recent research has revealed that the OsCIF1/2–OsSGN3a/b signaling pathway is involved in Casparian strip formation in rice, though the specific role of Os02g0743900 within this pathway requires further investigation .

How is Os02g0743900 related to other CASP family proteins?

Os02g0743900 is part of the larger CASP-like (CASPL) protein family found throughout the plant kingdom. Phylogenetic analysis has revealed that these proteins share homology with the MARVEL protein family found outside the plant kingdom . CASPs are evolutionarily correlated with the presence of Casparian strips in plants; organisms lacking Casparian strips (like bryophytes and green algae) contain CASPL proteins but lack the specific CASP extracellular loop 1 (EL1) signature that is conserved in plants with Casparian strips . Interestingly, even some parasitic plants like Striga asiatica that have modified root anatomy maintain a CASP homolog with the conserved EL1 signature, suggesting evolutionary importance .

What experimental approaches are most effective for studying Os02g0743900 localization and dynamics?

For studying Os02g0743900 localization and dynamics, multiple complementary approaches should be employed:

  • Fluorescent protein tagging: Fusion of GFP or other fluorescent proteins to Os02g0743900 allows visualization of its localization to the Casparian strip membrane domain (CSD). Time-lapse confocal microscopy can track the protein's movement from initial plasma membrane localization to its concentration at the CSD, providing insights into its turnover dynamics .

  • Membrane fractionation and immunolocalization: These techniques can confirm the transmembrane topology and domain organization of Os02g0743900. Specifically, differential detergent extraction can help determine the protein's association with membrane scaffolds .

  • FRAP (Fluorescence Recovery After Photobleaching): This technique is particularly valuable for measuring the turnover rate of Os02g0743900 at the CSD, as previous studies with related CASPs have demonstrated their extremely low turnover despite eventual removal .

  • Lipophilic dye diffusion assays: These can test whether Os02g0743900 creates effective membrane diffusion barriers by tracking whether fluorescent lipophilic molecules are blocked at the CSD .

  • Co-localization with known membrane domain markers: This approach can determine if Os02g0743900 restricts the diffusion of other membrane proteins like NOD26-LIKE INTRINSIC PROTEIN5;1 and BORON TRANSPORTER1 to create polar membrane domains .

What are the challenges and optimal methods for producing recombinant Os02g0743900 protein for in vitro studies?

Producing functional recombinant Os02g0743900 presents several challenges due to its transmembrane nature. The following approaches address these challenges:

  • Expression system selection: While E. coli can be used for initial production (as indicated for the commercially available His-tagged full-length protein) , membrane proteins often require eukaryotic expression systems. Rice cell cultures may be advantageous as they provide the native processing environment .

  • Optimization of solubilization: As a membrane protein, Os02g0743900 requires careful detergent selection for extraction while maintaining native conformation. A detergent screening panel including mild detergents (DDM, LMNG) is recommended.

  • Addressing glycosylation: Rice possesses complex post-translational glycosylation capabilities that may be important for Os02g0743900 function . If glycosylation is critical, using rice cell suspension cultures in bioreactors may be preferred over bacterial systems .

  • Purification strategy: A two-step purification approach using His-tag affinity chromatography followed by size exclusion chromatography can yield high-purity protein while maintaining the native tetramer/oligomer state that is likely critical for function .

  • Functional verification: Because transmembrane scaffolding is a key function, reconstitution into liposomes followed by biophysical assays is necessary to confirm that the recombinant protein maintains its ability to form membrane domains.

How can CRISPR-Cas9 genome editing be optimized for functional characterization of Os02g0743900?

For CRISPR-Cas9 editing of Os02g0743900, consider the following optimized approach:

  • Target site selection: Design sgRNAs targeting conserved transmembrane domains rather than variable regions. Since CASPs can be functionally redundant, consider multiplex editing to target additional family members simultaneously.

  • Validation strategy: Employ a tiered validation system including:

    • T7E1 assay for initial mutation detection

    • Deep sequencing to identify precise modifications

    • RT-qPCR to measure transcript levels

    • Western blotting to confirm protein expression changes

    • Microscopy to assess Casparian strip integrity using lignin-specific stains

  • Phenotyping protocol: Focus on:

    • Root hydraulic conductivity measurements

    • Nutrient uptake analysis

    • Ion leakage assays

    • Detailed confocal microscopy of root cross-sections with lignin staining

    • Stress response evaluations, particularly under drought or salinity conditions

  • Complementation testing: Reintroduce wild-type or modified Os02g0743900 variants to confirm phenotype rescue and perform domain function studies.

  • Interaction partner analysis: Combine CRISPR editing with co-immunoprecipitation to identify changes in the interaction network when Os02g0743900 is modified or absent.

What protein-protein interactions are essential for Os02g0743900 function in Casparian strip formation?

Based on studies of related CASP proteins, several key protein-protein interactions are likely critical for Os02g0743900 function:

  • CASP family oligomerization: Os02g0743900 likely forms homo-oligomers and potentially hetero-oligomers with other CASP family members to create the membrane scaffold at the Casparian strip membrane domain .

  • Peroxidase interactions: Direct interaction with secreted peroxidases is essential for mediating lignin deposition in the cell wall adjacent to the membrane domain . These interactions direct the lignin polymerization machinery to specific cell wall regions.

  • SCHENGEN3 (SGN3) pathway components: Recent research indicates that the OsCIF1/2–OsSGN3a/b signaling pathway is involved in Casparian strip formation in rice . Os02g0743900 may interact with components of this pathway to coordinate Casparian strip development.

  • Cytoskeletal anchoring proteins: To establish the stable membrane domain characteristic of CASPs, interactions with cytoskeletal elements may be required, though specific partners have not been fully characterized.

  • Cell wall modifying enzymes: Beyond peroxidases, other enzymes involved in cell wall modification may interact with Os02g0743900 to coordinate the complex process of Casparian strip formation.

To characterize these interactions, a combination of approaches including co-immunoprecipitation, yeast two-hybrid screening, and in planta bimolecular fluorescence complementation would provide comprehensive insights.

What expression systems are most suitable for recombinant Os02g0743900 production?

The optimal expression system for Os02g0743900 should be selected based on research goals:

  • E. coli expression: Suitable for producing large quantities for structural studies, as demonstrated by commercial availability of His-tagged recombinant protein . Key optimization points include:

    • Using specialized strains like Rosetta or C41/C43 for membrane protein expression

    • Employing fusion tags (MBP, SUMO) to enhance solubility

    • Optimizing induction conditions (low temperature, reduced IPTG concentration)

  • Rice cell suspension cultures: Provide native post-translational modifications and processing machinery . Advantages include:

    • Natural glycosylation patterns

    • Proper folding environment

    • Potential for scale-up in bioreactors

    • Lower risk of misfolding

  • Transient expression in plant leaves: Useful for rapid functional testing and localization studies. Consider:

    • Nicotiana benthamiana infiltration for quick results

    • Rice protoplast transformation for native context

  • Stable transgenic rice: Ideal for in vivo functional studies and provides the most physiologically relevant context . Options include:

    • Endodermis-specific promoters for tissue-targeted expression

    • Inducible expression systems for temporal control

    • Fluorescent protein fusions for localization studies

The choice should be guided by whether the research requires protein for biochemical/structural studies (favoring E. coli or cell cultures) or aims to understand in vivo function (favoring whole plant systems) .

How can researchers distinguish between Os02g0743900 and other CASP family members in functional studies?

To distinguish Os02g0743900 from other CASP family members in functional studies, researchers should implement a multi-faceted approach:

  • Sequence-specific tools:

    • Design highly specific antibodies targeting unique epitopes, particularly in the variable regions outside the conserved transmembrane domains

    • Develop qRT-PCR primers that span unique exon junctions

    • Create CRISPR-Cas9 guide RNAs targeting non-conserved regions

  • Expression pattern analysis:

    • Perform cell-type specific transcriptomics to identify unique expression patterns

    • Use promoter-reporter fusions to visualize spatial and temporal expression differences

    • Analyze expression under various stress conditions that may differentially regulate CASP family members

  • Protein localization studies:

    • Super-resolution microscopy to detect subtle differences in membrane domain localization

    • Time-course studies to identify differences in dynamic behavior (recruitment, stability, turnover)

    • Co-localization with known interacting partners that might be specific to Os02g0743900

  • Complementation experiments:

    • Express Os02g0743900 in knockout lines of other CASP members to test functional redundancy

    • Create chimeric proteins with domains swapped between CASP members to identify function-specific regions

  • Specific phenotypic assays:

    • Develop assays targeting cellular processes where Os02g0743900 function might be distinct from other family members

    • Use physiological stress conditions that might reveal Os02g0743900-specific roles

What techniques are most effective for analyzing Os02g0743900 post-translational modifications?

Analysis of Os02g0743900 post-translational modifications requires specialized approaches for membrane proteins:

  • Mass spectrometry approaches:

    • Liquid chromatography-tandem mass spectrometry (LC-MS/MS) following optimized membrane protein extraction

    • Multiple protease digestion strategies to improve sequence coverage

    • Enrichment techniques for specific modifications (e.g., TiO₂ for phosphopeptides, lectin affinity for glycopeptides)

    • Top-down proteomics for intact protein analysis to capture the full PTM landscape

  • Glycosylation analysis:

    • Rice expression systems provide complex post-translational glycosylation capabilities

    • Enzymatic deglycosylation followed by mobility shift analysis

    • Glycan profiling using specialized MS techniques (e.g., electron transfer dissociation)

    • Lectin blotting to identify specific glycan structures

  • Phosphorylation studies:

    • Phospho-specific antibodies for key regulatory sites

    • In vitro kinase assays to identify responsible kinases

    • Phosphomimetic and phospho-null mutations for functional testing

  • Ubiquitination and membrane protein turnover:

    • Cycloheximide chase assays to measure protein half-life

    • Ubiquitination site mapping by MS

    • Proteasome and lysosome inhibitors to determine degradation pathways

  • Lipid modifications:

    • Click chemistry approaches for detecting S-acylation

    • Metabolic labeling with palmitate analogs

    • Acyl-biotin exchange techniques for palmitoylation site identification

These techniques should be combined with functional assays to determine how specific modifications affect Os02g0743900 localization, stability, and activity in Casparian strip formation.

How has Os02g0743900 evolved compared to CASP proteins in other plant species?

The evolutionary history of Os02g0743900 reflects the broader evolution of CASP proteins in plants:

  • Evolutionary emergence: CASP-like (CASPL) proteins are found across green plants including green algae, but true CASPs with the specific extracellular loop 1 (EL1) signature appear to have evolved specifically in plants that form Casparian strips . Phylogenetic analysis suggests that CASP proteins share ancestry with the MARVEL protein family found outside the plant kingdom .

  • Conservation patterns: The transmembrane domains of CASPs show high sequence conservation, while the extracellular loops, particularly EL1, contain signature sequences that correlate with Casparian strip formation capability . Os02g0743900 bears this signature, consistent with rice's ability to form Casparian strips.

  • Functional specialization: Evolutionary analysis suggests that while the membrane scaffolding function is ancestral, the ability to direct lignin deposition may be a derived function of CASPs in vascular plants . This specialization would have been critical for the evolution of effective water and nutrient barriers in roots.

  • Rice-specific adaptations: The rice genome contains multiple CASP genes, suggesting potential functional diversification or tissue-specific roles that may reflect adaptation to rice's semi-aquatic lifestyle and specific root architecture.

  • Conservation in parasitic plants: Interestingly, even parasitic plants with modified root anatomy, such as Striga asiatica, maintain CASP homologs with conserved EL1 signatures , suggesting evolutionary pressure to maintain these proteins even when root function has been altered.

Comparative genomic analysis combined with functional testing of Os02g0743900 orthologs from different plant species would further illuminate the evolutionary trajectory and functional conservation of this important protein family.

What insights from Arabidopsis CASP research can be applied to studying Os02g0743900 in rice?

Arabidopsis CASP research provides valuable frameworks that can be applied to Os02g0743900 studies in rice:

  • Membrane domain formation: Arabidopsis studies have established that CASPs initially target the whole plasma membrane before localizing exclusively to the Casparian strip membrane domain (CSD) . Similar dynamic localization studies in rice would reveal whether Os02g0743900 follows the same pattern.

  • Diffusion barrier function: In Arabidopsis, the CASP domain creates a membrane diffusion barrier that restricts movement of proteins like NOD26-LIKE INTRINSIC PROTEIN5;1 and BORON TRANSPORTER1 . Testing whether Os02g0743900 creates similar diffusion barriers would confirm functional conservation.

  • Peroxidase interactions: Arabidopsis CASPs interact with peroxidases to mediate lignin deposition . Identifying rice peroxidases that interact with Os02g0743900 would help establish conservation of this mechanism.

  • SCHENGEN pathway: The SCHENGEN pathway regulates Casparian strip formation in Arabidopsis. Recent research indicates the OsCIF1/2–OsSGN3a/b signaling pathway plays a similar role in rice . Investigating Os02g0743900's relationship with this pathway would reveal regulatory conservation.

  • Extracellular loop function: Arabidopsis research has shown that extracellular loops are not necessary for CASP localization but are important for function . Domain swapping experiments between Arabidopsis CASPs and Os02g0743900 could reveal functional conservation of specific protein regions.

  • Multiple tissue barriers: Recent Arabidopsis research has revealed CASP involvement in multiple tissue barrier formation. Investigating whether Os02g0743900 functions in diverse rice tissues beyond the endodermis would extend our understanding of its roles .

How might genetic modification of Os02g0743900 impact rice stress tolerance?

Genetic modification of Os02g0743900 could significantly impact rice stress tolerance through several mechanisms:

  • Water-use efficiency: Casparian strips regulate water movement between soil and vascular tissue. Strategic modifications of Os02g0743900 could enhance drought tolerance by:

    • Strengthening the apoplastic barrier to reduce water loss

    • Modifying the timing of Casparian strip formation during development

    • Extending Casparian strip formation to additional cell layers for enhanced barrier function

  • Nutrient uptake regulation: Modified Os02g0743900 expression could improve:

    • Salinity tolerance by enhancing sodium exclusion at the endodermis

    • Nitrogen use efficiency by optimizing the selectivity of the apoplastic barrier

    • Heavy metal tolerance by increasing exclusion of toxic elements

  • Pathogen resistance: Enhanced Casparian strips could form stronger barriers against root pathogens by:

    • Restricting apoplastic movement of pathogens

    • Strengthening physical barriers at potential entry points

    • Potentially incorporating antimicrobial compounds into the lignin matrix

  • Developmental plasticity: Engineered conditional expression of Os02g0743900 could allow:

    • Environmental responsive barrier formation

    • Tissue-specific modification of water and nutrient uptake

    • Developmental stage-specific barrier properties

  • Potential trade-offs: Careful assessment would be needed to address:

    • Excessive restriction of beneficial nutrient uptake

    • Impact on beneficial microorganism colonization

    • Altered root hydraulic conductivity affecting growth under non-stress conditions

Experimental approaches should combine precise genome editing with comprehensive physiological phenotyping under various stress conditions to optimize modifications for agricultural benefit.

What are the methodological considerations for using Os02g0743900 as a tool in plant biotechnology?

Using Os02g0743900 as a biotechnological tool requires careful methodological considerations:

  • Promoter selection for transgenic applications:

    • Cell-type specific promoters for targeted expression (endodermis, exodermis, etc.)

    • Inducible promoters for temporal control of barrier formation

    • Stress-responsive promoters for conditional barrier enhancement

  • Protein engineering strategies:

    • Domain swapping with other CASPs to create chimeric proteins with novel properties

    • Modification of extracellular loops to alter interaction with cell wall components

    • Addition of functional domains to recruit specific enzymes or incorporate novel compounds into barriers

  • Experimental validation hierarchy:

    • Initial testing in rice cell cultures for protein expression and stability

    • Protoplast transformation for localization studies

    • Transgenic rice for comprehensive functional analysis

    • Field trials to assess agronomic impact and environmental interactions

  • Multi-omics monitoring:

    • Transcriptomics to assess effects on global gene expression

    • Metabolomics to identify changes in root exudates and metabolic profiles

    • Ionomics to quantify impacts on nutrient uptake and distribution

  • Phenotyping protocols:

    • Non-invasive imaging of root architecture and function

    • Water use efficiency measurements under controlled conditions

    • Nutrient uptake kinetics and distribution analysis

    • Stress tolerance phenotyping under field-relevant conditions

  • Biosafety considerations:

    • Monitoring for unintended consequences on beneficial soil microbiota

    • Assessment of potential impacts on non-target organisms

    • Evaluation of plant-soil-water interactions in relevant ecosystems

These methodological considerations should be integrated into a systematic research pipeline that moves from molecular characterization to field-relevant applications with appropriate biosafety assessment at each stage.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.