Recombinant Oryza sativa subsp. japonica Casparian strip membrane protein Os04g0460400 (Os04g0460400, LOC_Os04g38690)

Shipped with Ice Packs
In Stock

Description

Molecular Characterization

The recombinant Os04g0460400 protein is expressed in E. coli with an N-terminal His tag, yielding a full-length 186-amino acid polypeptide (20.1 kDa) . Key features include:

PropertyDetails
Amino Acid SequenceMEHGEISSKAPLVAPVAAGVNRAVAVVDTFLRFIAIIGTIGSAIAMGTTNETLPFFTQFIQFEAKYSDLPSFTFFVAANAVVCTYLVLSIPLSIVHILRPRARYSRLFLVFFDTAMLALLTAGASAAAAIVYLAHKGNVRANWFSICQQFDSFCERISGSLIGSFAAMVLLVVLITLSAFALARRH
DomainsFour transmembrane domains (predicted via SOSUI)
Purity>90% (SDS-PAGE)
StorageLyophilized or liquid in Tris/PBS buffer with 6% trehalose (pH 8.0)

Functional Role in Casparian Strip Formation

Os04g0460400 is essential for establishing the Casparian strip membrane domain (CSD), a scaffold that localizes lignin polymerization machinery to form CS in rice endodermis . Key findings:

  • Localization: Initially distributed across the plasma membrane, it later concentrates at anticlinal cell walls during CS formation .

  • Knockout Effects: Loss of OsCASP5 disrupts CS integrity, leading to mineral dysregulation and stunted growth under soil/hydroponic conditions .

  • Evolutionary Context: Belongs to the MARVEL protein family, conserved across land plants, with CASP-specific motifs critical for membrane scaffolding .

Research Applications

This recombinant protein is utilized in:

  1. Mechanistic Studies: Investigating CSD assembly and membrane-cell wall junction dynamics .

  2. Agricultural Biotechnology: Engineering crops with enhanced nutrient uptake or stress resilience .

  3. Protein Interaction Screens: Identifying partners involved in CS formation .

Comparative Analysis of CASP Proteins

FeatureOsCASP5AtCASP1 (Arabidopsis)
Length186 aa224 aa
ExpressionRoot elongation zone Endodermis maturation zone
FunctionCS scaffolding in endodermis CS scaffolding and lignin deposition

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them in your order notes. We will prepare according to your request.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributor for specific delivery details.
Note: All proteins are shipped with standard blue ice packs unless otherwise specified. If dry ice shipping is required, please contact us in advance. Additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default glycerol final concentration is 50%. Customers may use this as a reference.
Shelf Life
Shelf life is influenced by several factors, including storage conditions, buffer components, temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
Os04g0460400; LOC_Os04g38690; OsJ_014458; OSJNBa0072F16.8; Casparian strip membrane protein 5; OsCASP5
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-186
Protein Length
full length protein
Species
Oryza sativa subsp. japonica (Rice)
Target Names
Os04g0460400
Target Protein Sequence
MEHGEISSKAPLVAPVAAGVNRAVAVVDTFLRFIAIIGTIGSAIAMGTTNETLPFFTQFI QFEAKYSDLPSFTFFVAANAVVCTYLVLSIPLSIVHILRPRARYSRLFLVFFDTAMLALL TAGASAAAAIVYLAHKGNVRANWFSICQQFDSFCERISGSLIGSFAAMVLLVVLITLSAF ALARRH
Uniprot No.

Target Background

Function
This protein regulates membrane-cell wall junctions and localized cell wall deposition. It is essential for the establishment of the Casparian strip membrane domain (CSD) and the subsequent formation of Casparian strips, a cell wall modification of the root endodermis. The Casparian strip creates an apoplastic barrier between the intraorganismal apoplasm and the extraorganismal apoplasm, preventing lateral diffusion.
Protein Families
Casparian strip membrane proteins (CASP) family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is the subcellular localization pattern of Os04g0460400 in rice roots?

Os04g0460400 likely exhibits a specific localization pattern similar to other CASP proteins. Based on studies of related CASP proteins, this protein is expected to initially target the whole plasma membrane before being removed from lateral plasma membranes and becoming exclusively localized at the Casparian strip membrane domain (CSD) . To determine its precise localization:

  • Generate a translational fusion of Os04g0460400 with a fluorescent protein (such as mCitrine or GFP)

  • Express the fusion protein under the control of its native promoter

  • Visualize the protein localization using confocal microscopy

  • Compare with cell wall staining (calcofluor) and lignin staining (basic fuchsin)

Similar approaches with other CASP proteins have demonstrated their specific endodermal localization, as seen with SlCASP1 and SlCASP2 in tomato, which were not detected in the exodermis .

How does Os04g0460400 contribute to Casparian strip formation in rice?

Os04g0460400, like other CASP proteins, likely plays a dual role in Casparian strip formation:

  • Creating a membrane scaffold that forms a diffusion barrier between different plasma membrane domains

  • Directing cell wall modification through interactions with secreted peroxidases

These two functions can be uncoupled, as formation of the CASP domain is independent of lignin deposition, and interactions between CASPs and peroxidases can occur outside the CSD when CASPs are ectopically expressed .

To study its contribution:

  • Create knockout mutants using CRISPR-Cas9

  • Analyze the integrity of the Casparian strip using apoplastic tracer dyes

  • Examine lignin deposition patterns using histochemical staining

  • Investigate membrane domain formation using fluorescent lipid markers

What are the structural features of Os04g0460400?

Os04g0460400 likely possesses the characteristic structural features of CASP family proteins:

FeatureDescriptionFunction
Transmembrane domainsFour transmembrane spansMembrane anchoring and domain formation
Conserved residuesLocated primarily in transmembrane domainsPotentially involved in protein localization
MARVEL-like domainsShared with MARVEL protein familyMembrane apposition and vesicle trafficking

For comprehensive structural characterization:

  • Perform in silico analyses including hydrophobicity plots and transmembrane prediction

  • Use site-directed mutagenesis to identify essential residues for function

  • Conduct protein modeling to predict tertiary structure

  • Compare with known CASP protein structures to identify family-specific signatures

How can we assess the dynamics of Os04g0460400 turnover in the plasma membrane?

CASP proteins show extremely low turnover after localization to the CSD . To investigate Os04g0460400 dynamics:

  • Create an inducible fluorescent fusion system:

    • Use an estradiol-inducible promoter controlling Os04g0460400-GFP expression

    • Monitor protein appearance and disappearance after induction/removal

  • Implement Fluorescence Recovery After Photobleaching (FRAP):

    • Photobleach a section of the CSD containing Os04g0460400-GFP

    • Measure recovery time to determine protein mobility and replacement rate

  • Use protein lifetime tags:

    • Fuse Os04g0460400 with a destabilizing domain that responds to a small molecule

    • Quantify protein degradation rates in different cellular contexts

  • Compare results with known CASP turnover rates to identify unique characteristics of Os04g0460400

What methodologies are most effective for identifying interaction partners of Os04g0460400?

Understanding protein-protein interactions is crucial for elucidating Os04g0460400 function. Multiple complementary approaches should be employed:

  • Yeast Two-Hybrid (Y2H) screening:

    • Use Os04g0460400 as bait against a rice cDNA library

    • Verify interactions through directed Y2H as demonstrated for HDR1 and OsK4

  • Co-immunoprecipitation followed by mass spectrometry:

    • Express tagged Os04g0460400 in rice

    • Immunoprecipitate the protein complex and identify partners through mass spectrometry

    • Validate findings with reciprocal co-IP experiments

  • Bimolecular Fluorescence Complementation (BiFC):

    • Split a fluorescent protein between Os04g0460400 and potential partners

    • Analyze in protoplasts to visualize interaction sites, as demonstrated for HDR1-OsK4 interactions

  • Proximity-dependent biotinylation:

    • Fuse Os04g0460400 with a promiscuous biotin ligase

    • Identify nearby proteins through streptavidin pulldown and mass spectrometry

For validation, examine whether potential interactors overlap with known CASP-interacting proteins such as peroxidases involved in lignin deposition .

How can we resolve contradictory data regarding Os04g0460400 function in different rice varieties?

When facing contradictory functional data across rice varieties:

  • Conduct comparative analysis of Os04g0460400 sequences:

    • Align sequences from multiple varieties (japonica, indica, etc.)

    • Identify polymorphisms that might affect protein function

  • Implement reciprocal complementation tests:

    • Create knockout mutants in multiple varieties

    • Complement with Os04g0460400 variants from different backgrounds

    • Quantify restoration of phenotypes

  • Perform domain swapping experiments:

    • Exchange domains between Os04g0460400 variants showing functional differences

    • Identify which regions contribute to functional variation

  • Analyze epigenetic differences:

    • Compare promoter methylation and chromatin accessibility across varieties

    • Correlate with expression levels and phenotypic outcomes

This approach can identify whether functional differences are due to protein sequence variations, expression differences, or genetic background effects.

What are the best approaches for investigating Os04g0460400's role in abiotic stress responses?

To investigate the role of Os04g0460400 in abiotic stress responses:

  • Generate overexpression and knockout lines:

    • Create CRISPR-Cas9 knockout mutants

    • Develop constitutive and inducible overexpression lines

    • Include tissue-specific expression systems

  • Subject plants to multiple stress conditions:

    • Drought (using polyethylene glycol or soil drying)

    • Salinity (NaCl gradient treatments)

    • Heavy metals (focusing on barriers to uptake)

    • Nutrient deficiency (particularly minerals transported via apoplastic route)

  • Analyze barrier function under stress:

    • Measure apoplastic tracer penetration

    • Quantify ion accumulation in different tissues

    • Examine Casparian strip integrity through microscopy

  • Conduct transcriptomic analysis:

    • Compare wild-type and mutant responses to stress

    • Identify differentially regulated pathways

    • Focus on genes involved in barrier formation and permeability

This approach parallels methodologies used to establish the role of exodermal barriers in selectively restricting mineral ion uptake .

How can we differentiate between the membrane domain formation and cell wall modification functions of Os04g0460400?

CASP proteins have dual functions that can be uncoupled . To investigate these separate roles in Os04g0460400:

  • Create targeted mutations:

    • Design mutations in domains predicted to interact with cell wall modification enzymes

    • Preserve transmembrane domains responsible for membrane localization

    • Generate complementary mutations affecting membrane localization but not enzyme interaction

  • Analyze through fluorescent protein fusions:

    • Visualize membrane domain formation with fluorescent protein tags

    • Track co-localization with membrane domain markers

  • Assess cell wall modification:

    • Stain for lignin deposition using basic fuchsin

    • Analyze cell wall composition through biochemical assays

    • Measure peroxidase activity in proximity to the protein

  • Implement inducible dimerization systems:

    • Force interaction between Os04g0460400 and peroxidases through chemical induction

    • Determine whether artificial interaction can bypass natural regulation

These approaches can reveal whether Os04g0460400's functions in membrane domain formation and cell wall modification can be separated, as demonstrated for other CASP proteins .

What methodologies are recommended for phylogenetic analysis of Os04g0460400 within the CASP/CASPL family?

To conduct robust phylogenetic analysis:

  • Sequence retrieval and alignment:

    • Collect CASP and CASPL sequences from diverse plant species

    • Include MARVEL family proteins as outgroups

    • Use multiple sequence alignment tools (MUSCLE, MAFFT, T-Coffee)

    • Manually curate alignments focusing on transmembrane domains

  • Phylogenetic tree construction:

    • Apply multiple methods (Maximum Likelihood, Bayesian inference)

    • Implement appropriate evolutionary models

    • Assess node support through bootstrapping or posterior probabilities

  • Detect conserved motifs and signatures:

    • Identify CASP-specific signatures absent in plants lacking Casparian strips

    • Map functionally important residues across the phylogeny

    • Correlate sequence features with known functional differences

  • Analyze evolutionary rates:

    • Calculate selection pressures (dN/dS ratios)

    • Identify sites under positive or purifying selection

    • Compare evolutionary rates between different plant lineages

How should experiments be designed to compare functional conservation between Os04g0460400 and other CASP proteins?

To assess functional conservation:

  • Heterologous expression experiments:

    • Express Os04g0460400 in Arabidopsis casp mutants

    • Express Arabidopsis CASPs in rice os04g0460400 mutants

    • Quantify complementation of phenotypes

  • Domain swapping:

    • Create chimeric proteins between Os04g0460400 and other CASPs

    • Test localization and function of chimeric proteins

    • Identify domains responsible for species-specific functions

  • Compare interaction networks:

    • Identify conservation of protein-protein interactions

    • Determine whether interaction partners are conserved across species

    • Assess whether interaction mechanisms are preserved

  • Analyze expression patterns:

    • Compare tissue-specificity and developmental timing

    • Assess responses to environmental stimuli

    • Determine whether regulatory mechanisms are conserved

These approaches can reveal whether Os04g0460400 functions are conserved with other CASP proteins or whether this protein has evolved specialized roles in rice.

What cutting-edge methodologies can be applied to study Os04g0460400 in living tissues?

To leverage advanced technologies:

  • CRISPR-Cas9 genome editing strategies:

    • Generate precise knockouts, knockdowns, and base edits

    • Create conditional alleles using inducible systems

    • Implement multiplexed editing for related genes

  • Live-cell super-resolution microscopy:

    • Apply techniques like PALM, STORM, or STED

    • Track protein dynamics at nanometer resolution

    • Visualize interactions with other components

  • Optogenetic approaches:

    • Control protein activity using light-sensitive domains

    • Manipulate protein interactions spatiotemporally

    • Induce conformational changes in specific cells

  • Single-cell transcriptomics and proteomics:

    • Analyze cell-specific responses to Os04g0460400 manipulation

    • Identify downstream effects in different cell populations

    • Map regulatory networks at single-cell resolution

These technologies can provide unprecedented insights into Os04g0460400 function in living tissues and overcome limitations of traditional approaches.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.