Recombinant Oryza sativa subsp. japonica Cellulose synthase-like protein E1 (CSLE1)

Shipped with Ice Packs
In Stock

Description

Molecular Characterization

CSLE1 belongs to the Cellulose Synthase-Like (CSL) superfamily, which includes enzymes involved in synthesizing hemicelluloses like xyloglucans and mannans . The recombinant form is expressed in E. coli or mammalian cells with an N-terminal His tag for purification . Key properties include:

ParameterDetails
UniProt IDQ651X7
Protein LengthFull-length (1–737 amino acids) or partial sequences, depending on product
Source OrganismOryza sativa subsp. japonica (rice)
Expression SystemE. coli (full-length) , mammalian cells (partial)
Purity>85%–90% (SDS-PAGE verified)
StorageLyophilized powder at -20°C/-80°C; reconstituted in Tris/PBS buffer
ReconstitutionRequires deionized water; glycerol (5%–50%) for long-term stability

Genomic Context and Evolution

  • Gene Locus: CSLE1 (synonyms: Os09g0478100, LOC_Os09g30120) is located on chromosome 9 of O. sativa subsp. japonica .

  • Phylogeny: CSLE1 belongs to the CSLE subfamily, which is evolutionarily distinct from CSLA and CSLC families involved in mannan and xyloglucan biosynthesis . Comparative genomics reveals lineage-specific expansions in grass species, suggesting adaptive roles in cell wall diversification .

  • Synteny: The CSL superfamily exhibits extensive synteny across angiosperms, with conserved functional domains despite species-specific gene duplications .

Functional Insights

While direct enzymatic activity data for CSLE1 is limited, its classification within the CSL superfamily provides functional clues:

  • Putative Role: CSLE1 is hypothesized to synthesize β-linked glycans, potentially contributing to rice cell wall architecture .

  • Ethylene Response: Related CSLC genes in rice are upregulated by ethylene during root growth, suggesting CSL proteins may mediate stress-responsive cell wall remodeling .

  • Redundancy: Functional overlap with other CSL genes (e.g., CSLC2, CSLC9) implies compensatory mechanisms in polysaccharide biosynthesis .

Research Applications

Recombinant CSLE1 is used for:

  • Enzymatic Assays: Investigating substrate specificity and kinetic parameters.

  • Antibody Production: Generating antibodies for localization studies.

  • Structural Studies: Analyzing 3D conformation via X-ray crystallography or cryo-EM.

Key Challenges and Future Directions

  • Functional Validation: Heterologous expression systems (e.g., Arabidopsis) are needed to confirm CSLE1’s biochemical activity .

  • Regulatory Networks: Linking CSLE1 expression to hormonal or environmental cues (e.g., ethylene signaling) .

  • Biotechnological Potential: Engineering CSLE1 to modulate rice cell wall composition for improved biomass yield .

Product Specs

Form
Lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice shipping is specifically requested and agreed upon in advance (additional fees apply).
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to pellet the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and may serve as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms maintain stability for 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
The tag type will be determined during production. If a specific tag is required, please inform us for preferential development.
Synonyms
CSLE1; Os09g0478100; LOC_Os09g30120; OsJ_028602; P0556A05.31-1; P0556A05.31-2; Cellulose synthase-like protein E1; OsCslE1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-737
Protein Length
full length protein
Species
Oryza sativa subsp. japonica (Rice)
Target Names
CSLE1
Target Protein Sequence
METTAAATAAERRRPLFTTEELGGRAVYRVQAATVAAGILLVLYYRATRVPAAGEGRAAW LGMAAAELWFAVYWVIAQSVRWRPFRRRTFRDRLAERYEQNLPGVDIFVCTADPQSEPPS LVISTILSVMAYNYPSEKISVYLSDDGGSILTFYALWEASIFAKKWLPFCKRYNIEPRSP AAYFSESKVHHNLCIPKEWALIKNLYEEMRERIDTATMSGKIPEEMKLKHKGFDEWNSDF TLKNHQPIVQILIDGKNRNAIDDDRNVLPTMVYVAREKRPQYHHNFKAGALNALIRVSSV ISDSPVILNVDCDMYSNNSDSIRDALCFFLDEEMGQKIGFVQYPQIFNNMTQNDIYGNSF NVSYHVEMCGLDSVGGCLYIGTGCFHRREILCGRIFSKDYKENWNRGIKERGKENINEIE EKATSLVTCTYEHRTQWGNDIGVKYGFPAEDIITGLAIHCRGWESAFINPKRAAFLGLAP STLAQNILQHKRWSEGNLTIFLSKYCSFLFGHGKIKLQLQMGYCICGLWAANSLPTLYYV VIPSLGLVKGTPLFPQIMSPWATPFIYVFCVKTLYGLYEALLSGDTLKGWWNGQRMWMVK SITSYLYGFIDTIRKCVGMSKMSFEVTAKVSGHDEAKRYEQEILEFGSSSPEYVIIATVA LLNFVCLVGGLSQIMAGVWNMPWNVFLPQAILCGMIVIINMPIYEAMFLRKDNGRIPTAV TLASIGFVMLAFLVPIV
Uniprot No.

Target Background

Function
This protein is believed to be a Golgi-localized β-glycan synthase responsible for polymerizing the backbones of non-cellulosic polysaccharides (hemicelluloses) within the plant cell wall.
Database Links

KEGG: osa:4347370

STRING: 39947.LOC_Os09g30120.1

UniGene: Os.6165

Protein Families
Glycosyltransferase 2 family, Plant cellulose synthase-like E subfamily
Subcellular Location
Golgi apparatus membrane; Multi-pass membrane protein.

Q&A

What is CSLE1 and what is its role in Oryza sativa?

Cellulose synthase-like protein E1 (CSLE1) belongs to the cellulose synthase-like protein family in rice (Oryza sativa). While not directly documented in the provided research materials, we can draw parallels with other characterized rice proteins. Similar to how Ory s 1 functions as an expansin involved in cell wall modification , CSLE1 likely participates in cell wall biogenesis through the synthesis of non-cellulosic polysaccharides. These proteins typically contain conserved catalytic domains responsible for polysaccharide synthesis and may play crucial roles in plant development, particularly in cell wall formation and modification during growth stages.

How is recombinant CSLE1 typically expressed and purified?

Recombinant CSLE1 from Oryza sativa subsp. japonica would typically be expressed using prokaryotic expression systems such as E. coli, similar to the approach used for Ory s 1 protein . The expression process would involve:

  • Cloning the CSLE1 gene sequence into an appropriate expression vector

  • Transformation of the vector into a suitable E. coli strain

  • Induction of protein expression under optimized conditions

  • Cell harvesting and lysis

  • Protein purification via affinity chromatography, typically using an N-terminal histidine tag

  • Quality control assessment via SDS-PAGE

The purified protein would likely be supplied in a stabilizing buffer, similar to the formulation used for Ory s 1 (50 mM Na₂HPO₄, pH 7.4, with NaCl and potentially urea or other stabilizers) .

What are the standard storage conditions for recombinant CSLE1?

Based on comparable recombinant proteins from Oryza sativa, the recommended storage conditions for recombinant CSLE1 would be -20°C . During shipping and short-term handling, the protein should be maintained on blue ice to preserve stability and activity. For aliquoted samples, avoid repeated freeze-thaw cycles as these may compromise protein integrity. The stability period at -20°C is typically 12-24 months, though activity testing may be recommended for samples stored longer than one year.

How does the structure of CSLE1 compare to other cellulose synthase-like proteins in rice?

While specific structural data for CSLE1 is not provided in the search results, we can infer its structural features by examining characterized rice proteins. Like other rice proteins such as EL1 and COI homologues, CSLE1 likely contains highly conserved catalytic domains . The protein would be expected to share structural similarities with other cellulose synthase-like proteins, including:

  • A conserved catalytic core for nucleotide sugar binding

  • Transmembrane domains for membrane anchoring

  • Potentially specific substrate binding sites

  • Regulatory domains that may interact with other cellular components

Molecular modeling approaches, similar to those used for analyzing OsCOI proteins , could be applied to predict the three-dimensional structure of CSLE1 and identify key functional domains.

What post-translational modifications are important for CSLE1 function?

Based on studies of other rice proteins, phosphorylation is likely a critical post-translational modification for CSLE1 regulation. The EL1 study demonstrates how phosphorylation of the SLR1 protein by a casein kinase I significantly impacts protein stability and activity in rice . For CSLE1, potential phosphorylation sites could be predicted using computational analysis similar to the approach used for SLR1, which identified phosphorylation sites at Ser196 and Ser510 . Other potential post-translational modifications might include:

  • Glycosylation, which could affect protein folding and stability

  • Ubiquitination, which may regulate protein turnover, similar to COI1's role in protein degradation

  • Disulfide bond formation, potentially important for structural integrity

Experimental verification of these modifications would require mass spectrometry analysis and targeted mutagenesis of predicted modification sites.

How does CSLE1 interact with other proteins in cellulose biosynthesis pathways?

Similar to how OsCOI proteins interact with JAZ proteins in jasmonate signaling , CSLE1 likely participates in protein-protein interactions within cellulose biosynthesis pathways. Potential interaction partners could include:

Potential Interaction PartnersPredicted Interaction TypeFunctional Significance
Other CESA/CSL proteinsComplex formationAssembly of functional cellulose synthase complexes
Scaffolding proteinsAnchoringProper localization at plasma membrane
Regulatory kinasesPhosphorylationActivity regulation
Trafficking factorsTransport assistanceDelivery to cell membrane

Yeast two-hybrid assays, as used to examine OsCOI-JAZ interactions , would be an appropriate method to identify CSLE1 binding partners. Co-immunoprecipitation followed by mass spectrometry could further validate these interactions in planta.

What expression system is optimal for producing functional recombinant CSLE1?

While E. coli is commonly used for recombinant protein production, as demonstrated for Ory s 1 protein , membrane-associated proteins like CSLE1 may present challenges in prokaryotic systems. Researchers should consider:

  • Prokaryotic systems (E. coli):

    • Advantages: High yield, rapid growth, cost-effective

    • Limitations: May lack proper folding or post-translational modifications

    • Optimization: Use strains designed for membrane proteins, lower induction temperature

  • Eukaryotic systems:

    • Insect cells: Better for complex proteins requiring proper folding

    • Yeast: Suitable for glycosylated proteins

    • Plant-based expression: Most native-like modifications but lower yield

For CSLE1, a plant-based expression system might provide the most physiologically relevant protein, while E. coli with an N-terminal histidine tag might offer the highest yield for structural studies.

How can researchers assess the activity of recombinant CSLE1?

Activity assays for recombinant CSLE1 would need to measure its ability to synthesize specific polysaccharides. Drawing from approaches used for other enzymes, potential activity assessment methods include:

  • In vitro polysaccharide synthesis assays measuring incorporation of radiolabeled sugar nucleotides

  • Analysis of reaction products using HPLC, mass spectrometry, or specific glycan antibodies

  • Complementation studies in csle1 mutant plants, similar to the complementation approach used for coi1-1 mutants with OsCOI genes

Activity could be confirmed by demonstrating that CSLE1 synthesizes the expected polysaccharide product, with appropriate controls including catalytically inactive mutant versions of the protein.

What are the challenges in purifying membrane-associated proteins like CSLE1?

Membrane-associated proteins present distinct purification challenges. Based on experience with similar proteins:

  • Solubilization: Requires careful selection of detergents to extract the protein without denaturation

  • Maintaining native conformation: Critical for functional studies

  • Detergent removal: May be necessary for certain applications

  • Stability: Membrane proteins often have limited stability once removed from the membrane environment

A potential purification workflow for CSLE1 would include:

  • Membrane fraction isolation from expression host

  • Solubilization with mild detergents (e.g., DDM, CHAPS)

  • Affinity purification using the N-terminal histidine tag

  • Size exclusion chromatography for further purification

  • Assessment of purity using SDS-PAGE and western blotting

What strategies can overcome low expression yields of recombinant CSLE1?

Researchers frequently encounter low yields when expressing membrane proteins like CSLE1. Effective optimization strategies include:

  • Codon optimization for the expression host

  • Testing multiple expression vectors with different promoters and fusion tags

  • Screening various E. coli strains (BL21, Rosetta, C41/C43 specifically designed for membrane proteins)

  • Optimizing induction conditions:

    • IPTG concentration (typically 0.1-1.0 mM)

    • Induction temperature (often lowered to 16-25°C)

    • Induction duration (extended to 16-24 hours at lower temperatures)

  • Adding stabilizing agents during extraction (glycerol, specific detergents)

Additionally, expressing truncated versions containing only the catalytic domain might improve yields while still providing valuable functional insights.

How can researchers validate the structural integrity of purified CSLE1?

Validation of structural integrity is crucial for meaningful functional studies. Recommended approaches include:

  • Circular dichroism (CD) spectroscopy to assess secondary structure content

  • Thermal shift assays to evaluate protein stability

  • Size exclusion chromatography with multi-angle light scattering (SEC-MALS) to confirm monomeric state or oligomerization status

  • Limited proteolysis to verify proper folding

  • Activity assays to confirm functional integrity

For CSLE1, comparison of these parameters with native protein (if available) or with recombinant protein expressed in different systems would provide additional validation of structural integrity.

What mutagenesis approaches can identify key functional residues in CSLE1?

Site-directed mutagenesis provides powerful insights into protein function. For CSLE1, researchers could employ strategies similar to those used for other rice proteins:

  • Alanine scanning of predicted catalytic residues

  • Mutation of predicted phosphorylation sites, similar to the S196A/D and S510A/D mutations in SLR1

  • Domain swapping with other cellulose synthase-like proteins to identify specificity-determining regions

  • Generation of chimeric proteins to map functional domains

The efficacy of mutations can be assessed through:

  • In vitro activity assays

  • Yeast two-hybrid assays to test protein-protein interactions

  • Complementation studies in appropriate mutant backgrounds

  • Subcellular localization studies to verify proper trafficking

How should researchers analyze CSLE1 expression patterns across different rice tissues and developmental stages?

Comprehensive expression analysis provides crucial context for functional studies. Researchers should consider:

  • qRT-PCR analysis across multiple tissues and developmental stages, similar to the approach used for EL1

  • RNA-seq data mining from public databases

  • Promoter-reporter fusion studies to visualize expression patterns in planta

  • Protein-level analysis using specific antibodies or epitope-tagged versions

Expression data should be normalized appropriately and analyzed for:

  • Tissue specificity

  • Developmental regulation

  • Response to environmental stresses

  • Co-expression with functionally related genes

These patterns can provide insights into biological functions and guide further experimental designs.

What bioinformatic approaches can predict CSLE1 functional domains and interactions?

Multiple bioinformatic tools can provide valuable insights into CSLE1 structure and function:

  • Sequence alignment with characterized cellulose synthase-like proteins

  • Domain prediction using tools like SMART, Pfam, and InterPro

  • Secondary structure prediction

  • Molecular modeling, similar to the approach used for OsCOI proteins

  • Phosphorylation site prediction using tools like ScanSite, similar to the approach used for SLR1

Analysis TypeRecommended ToolsExpected Insights
Sequence AnalysisClustal Omega, MUSCLEConservation patterns, evolutionary relationships
Domain PredictionSMART, Pfam, InterProFunctional domain architecture
Structure PredictionSWISS-MODEL, I-TASSER3D structural model
Interaction PredictionSTRING, BioGRIDPotential protein-protein interactions
Post-translational ModificationNetPhos, ScanSitePotential regulatory sites

These predictions should guide experimental design but require experimental validation.

How can researchers determine if CSLE1 variants have altered functions in vivo?

Functional characterization of CSLE1 variants requires robust in vivo approaches. Based on strategies used for other rice proteins , researchers could:

  • Generate transgenic rice lines expressing:

    • Wild-type CSLE1 (control)

    • CSLE1 variants with mutations in key residues

    • CSLE1 fused to fluorescent proteins for localization studies

  • Perform complementation studies in csle1 mutant backgrounds, similar to the approach used for coi1-1 complementation with OsCOI genes

  • Analyze phenotypic effects on:

    • Plant growth and development

    • Cell wall composition

    • Response to environmental stresses

  • Conduct biochemical analyses:

    • Cell wall polysaccharide composition

    • Protein-protein interaction profiles

    • Subcellular localization patterns

Combining these approaches would provide comprehensive insights into how specific amino acid changes affect CSLE1 function in physiologically relevant contexts.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.