Recombinant Oryza sativa subsp. japonica Cellulose synthase-like protein E2 (CSLE2)

Shipped with Ice Packs
In Stock

Description

Functional Role in Plant Cell Wall Biosynthesis

CSLE2 belongs to the cellulose synthase-like (CSL) superfamily and is hypothesized to function as a Golgi-localized β-glycan synthase, polymerizing hemicellulose backbones critical for cell wall integrity . Key insights include:

  • Hemicellulose Synthesis: CSLE2 contributes to the formation of non-cellulosic polysaccharides, which cross-link cellulose microfibrils in plant cell walls .

  • Evolutionary Conservation: Comparative genomic studies reveal that CSL genes in Oryza sativa share functional domains with Arabidopsis thaliana, suggesting conserved roles in cell wall dynamics across angiosperms .

Research Applications

Recombinant CSLE2 is primarily used to:

  1. Investigate enzymatic mechanisms of hemicellulose synthesis in vitro.

  2. Study genetic regulation of cell wall biogenesis in monocots.

  3. Compare functional divergence among CSL family members (e.g., CSLA, CSLC, CSLD) .

Genomic and Evolutionary Insights

  • Gene Annotation: CSLE2 is part of the curated Oryza sativa genome, with functional domains identified in 70% of its protein-coding regions .

  • Duplication Events: Rice has undergone fewer lineage-specific gene duplications compared to Arabidopsis, yet retains similar distributions of paralog clusters, implying selective constraints on gene copy numbers .

Comparative Analysis with Arabidopsis thaliana

FeatureOryza sativa CSLE2Arabidopsis thaliana Homologs
Functional DomainsSimilar to CSL superfamilyShared β-glycan synthase domains
LocalizationGolgi apparatus Golgi/plasma membrane
Gene Duplications~0.39 duplicates per gene~0.46 duplicates per gene

Future Research Directions

  1. Structural Studies: Resolving the 3D structure of CSLE2 to elucidate substrate-binding mechanisms.

  2. Pathway Engineering: Modifying hemicellulose composition for biofuel or agricultural applications.

  3. Stress Responses: Investigating roles in biotic/abiotic stress adaptation, as seen in related CSLD proteins .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a reference.
Shelf Life
Shelf life depends on several factors: storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is crucial for multiple uses. Prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us for preferential development.
Synonyms
CSLE2; Os02g0725300; LOC_Os02g49332; Cellulose synthase-like protein E2; OsCslE2
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-745
Protein Length
full length protein
Species
Oryza sativa subsp. japonica (Rice)
Target Names
CSLE2
Target Protein Sequence
MAGSGGGVVSGGRQRGPPLFATEKPGRMAMAAYRVSAATVFAGVLLIWLYRATHLPPGGG DGVRRWAWLGMLAAELWFGFYWVLTLSVRWCPVYRRTFKDRLAQSYSEDELPSVDIFVCT ADPTAEPPMLVISTVLSVMAYDYLPEKLNIYLSDDAGSVLTFYVLCEASEFAKHWIPFCK KYKVEPRSPAAYFAKVASPPDGCGPKEWFTMKELYKDMTDRVNSVVNSGRIPEVPRCHSR GFSQWNENFTSSDHPSIVQILIDSNKQKAVDIDGNALPTLVYMAREKKPQKQHHFKAGSL NALIRVSSVISNSPIIMNVDCDMYSNNSESIRDALCFFLDEEQGQDIGFVQYPQNFENVV HNDIYGHPINVVNELDHPCLDGWGGMCYYGTGCFHRREALCGRIYSQEYKEDWTRVAGRT EDANELEEMGRSLVTCTYEHNTIWGIEKGVRYGCPLEDVTTGLQIQCRGWRSVYYNPKRK GFLGMTPTSLGQILVLYKRWTEGFLQISLSRYSPFLLGHGKIKLGLQMGYSVCGFWAVNS FPTLYYVTIPSLCFLNGISLFPEKTSPWFIPFAYVMVAAYSCSLAESLQCGDSAVEWWNA QRMWLIRRITSYLLATIDTFRRILGISESGFNLTVKVTDLQALERYKKGMMEFGSFSAMF VILTTVALLNLACMVLGISRVLLQEGPGGLETLFLQAVLCVLIVAINSPVYEALFLRRDK GSLPASVARVSICFVLPLCILSICK
Uniprot No.

Target Background

Function

Function: This protein is believed to be a Golgi-localized β-glycan synthase responsible for polymerizing the backbones of non-cellulosic polysaccharides (hemicelluloses) within the plant cell wall.

Database Links
Protein Families
Glycosyltransferase 2 family, Plant cellulose synthase-like E subfamily
Subcellular Location
Golgi apparatus membrane; Multi-pass membrane protein.

Q&A

What gene identifiers and nomenclature are associated with CSLE2?

The CSLE2 protein is encoded by the CSLE2 gene in rice, which has the following identifiers:

  • Gene name: CSLE2

  • Alternative name: OsCslE2

  • Ordered Locus Names: Os02g0725300, LOC_Os02g49332

  • Enzyme Commission number: EC= 2.4.1.-

These identifiers are crucial for database searches, literature reviews, and ensuring consistent terminology in publications .

What is the optimal storage and handling protocol for recombinant CSLE2?

For optimal preservation of protein activity, recombinant CSLE2 should be:

  • Stored at -20°C/-80°C upon receipt

  • Aliquoted to prevent repeated freeze-thaw cycles

  • Reconstituted in deionized sterile water to 0.1-1.0 mg/mL

  • Supplemented with 5-50% glycerol (final concentration) for long-term storage

  • Working aliquots can be stored at 4°C for up to one week

Improper storage significantly impacts protein stability and experimental reproducibility. When designing multi-day experiments, consider preparing fresh working aliquots rather than subjecting samples to repeated temperature changes .

How should researchers design experiments to study CSLE2's role in cell wall formation?

When investigating CSLE2's function in cell wall formation, consider a multi-faceted experimental approach:

  • Gene expression analysis: Quantify CSLE2 expression under various conditions (e.g., ethylene treatment) using qRT-PCR

  • Cellular localization studies: Use fluorescently-tagged CSLE2 to track subcellular localization

  • Cell wall component analysis: Measure changes in monosaccharide composition, particularly xylose residues and cellulose content

  • Genetic manipulation: Generate overexpression lines and knockout/knockdown mutants

  • Microscopy analysis: Examine cell wall thickness and structure changes using techniques like transmission electron microscopy

Recent research demonstrates that ethylene treatment significantly increases xylose residues and cellulose content in wild-type rice roots but not in OsEIL1 mutants, suggesting a regulatory relationship worth investigating in your experimental design .

What controls should be included when studying CSLE2 in ethylene response experiments?

To ensure robust results when studying CSLE2's role in ethylene-mediated responses:

  • Genetic controls: Include wild-type plants alongside OsEIL1-deficient lines to establish ethylene signaling dependency

  • Treatment controls:

    • Ethylene-treated samples

    • Mock-treated samples

    • Ethylene biosynthesis inhibitor treatment

    • Ethylene perception inhibitor treatment

  • Time-course experiments: Sample at multiple time points (0h, 6h, 12h, 24h, 48h) to capture dynamic responses

  • Tissue-specific analysis: Compare responses in different root regions (tip, elongation zone, mature zone)

  • Expression validation: Verify changes in CSLE2 expression alongside known ethylene-responsive genes

The experimental design should account for the fact that OsCSLC2 acts downstream of ETHYLENE-INSENSITIVE3-LIKE1 (OsEIL1)-mediated ethylene signaling, with OsEIL1 directly activating CSLE2 expression .

What is the primary function of CSLE2 in plant cell walls?

CSLE2 belongs to the CELLULOSE SYNTHASE-LIKE C family and plays a crucial role in xyloglucan biosynthesis, particularly in rice root epidermal cells. Research demonstrates that:

  • CSLE2 and its homologs (CSLE1, 7, 9, 10) are involved in xyloglucan production

  • Xyloglucan is a major hemicellulose component that binds to cellulose microfibrils

  • This interaction contributes to cell wall strength and restricts cell expansion

  • CSLE2-mediated xyloglucan biosynthesis regulates root growth plasticity by limiting cell wall extension

The protein functions as a glycosyltransferase (EC 2.4.1.-), catalyzing the transfer of sugar moieties to form the xyloglucan backbone. This understanding is essential for researchers investigating cell wall remodeling and plant growth regulation .

How does CSLE2 interact with plant hormone signaling pathways?

CSLE2 functions within a complex hormonal regulatory network:

  • Ethylene pathway interaction:

    • Ethylene induces CSLE2 expression through direct activation by OsEIL1

    • CSLE2 acts downstream of ETHYLENE-INSENSITIVE3-LIKE1 (OsEIL1) transcription factor

    • This activation leads to increased xyloglucan biosynthesis and cell wall thickening

  • Auxin pathway crosstalk:

    • Auxin signaling pathways synergistically interact with ethylene in regulating CSLE2

    • This crosstalk modulates root growth restriction during ethylene response

This regulatory relationship positions CSLE2 as a critical mediator connecting hormone signaling with structural changes in the cell wall. When designing experiments, consider using hormone biosynthesis inhibitors or signaling mutants to dissect these interactions .

What techniques are recommended for isolating and analyzing cell wall components in CSLE2 studies?

For comprehensive cell wall analysis in CSLE2 research:

  • Cell wall isolation:

    • Extract alcohol-insoluble residues (AIR) from plant tissues

    • Sequential extraction with ammonium oxalate, sodium hydroxide, and sulfuric acid

    • Separate fractions containing pectins, hemicelluloses, and cellulose

  • Compositional analysis:

    • High-performance anion-exchange chromatography (HPAEC) for monosaccharide composition

    • Anthrone assay for total cellulose content

    • Immunolabeling with xyloglucan-specific antibodies for localization studies

  • Structural analysis:

    • Size-exclusion chromatography for polymer size distribution

    • Nuclear magnetic resonance (NMR) spectroscopy for detailed structural information

When examining ethylene effects, pay particular attention to xylose residues, which show significant increases in response to ethylene treatment in wild-type plants but not in ethylene signaling mutants .

What expression systems are suitable for producing functional recombinant CSLE2 protein?

For optimal recombinant CSLE2 production:

  • E. coli expression system:

    • Common for high-yield production of recombinant CSLE2

    • Typically produces protein with N-terminal His-tag for purification

    • Results in lyophilized powder formulation with >90% purity (SDS-PAGE)

    • Appropriate for biochemical studies and antibody production

  • Alternative expression systems to consider:

    • Yeast expression for proteins requiring eukaryotic post-translational modifications

    • Plant-based expression for native folding environment

    • Cell-free systems for membrane-associated domains

  • Purification approaches:

    • Nickel affinity chromatography for His-tagged proteins

    • Size exclusion chromatography for final polishing

    • Storage in Tris/PBS-based buffer with 6% Trehalose at pH 8.0

Current commercial recombinant CSLE2 preparations use E. coli expression systems with N-terminal His-tags, providing full-length protein (1-745aa) with high purity suitable for most research applications .

How can researchers investigate the relationship between CSLE2 and other cell wall synthesis genes?

To explore CSLE2's functional relationships with other cell wall-related genes:

  • Co-expression analysis:

    • RNA-seq data reveals that ethylene induces expression of multiple cell wall synthesis genes alongside CSLE2

    • Key related genes include CELLULOSE SYNTHASE A3, 4, 7, 9 (OsCESA3, 4, 7, 9) and CELLULOSE SYNTHASE-LIKE C1, 7, 9, 10

  • Protein-protein interaction studies:

    • Co-immunoprecipitation to identify physical interactions

    • Bimolecular fluorescence complementation (BiFC) to visualize interactions in planta

    • Yeast two-hybrid screening for novel interacting partners

  • Genetic interaction analysis:

    • Generate double/triple mutants combining CSLE2 with other cell wall synthesis genes

    • Phenotypic analysis of mutant combinations can reveal synergistic or epistatic relationships

  • Comparative promoter analysis:

    • Identify common regulatory elements in CSLE2 and other ethylene-responsive cell wall genes

    • Test promoter-reporter fusions to validate shared regulatory mechanisms

This multi-layered approach will provide insights into functional redundancy and specificity among cell wall synthesis genes during hormone responses .

What methodologies can reveal the mechanism of CSLE2 regulation by OsEIL1?

To elucidate the molecular mechanisms of CSLE2 regulation by OsEIL1:

  • Chromatin immunoprecipitation (ChIP):

    • Determine if OsEIL1 directly binds to the CSLE2 promoter

    • Identify specific binding motifs using ChIP-seq approach

  • Electrophoretic mobility shift assay (EMSA):

    • Confirm direct binding of OsEIL1 to specific CSLE2 promoter elements

    • Map the precise binding sites through competitive binding assays

  • Promoter-reporter studies:

    • Generate truncated and mutated CSLE2 promoter constructs

    • Identify essential regulatory regions responsive to ethylene/OsEIL1

  • Transcriptional regulation analysis:

    • Quantify CSLE2 expression in wild-type vs. OsEIL1 mutant backgrounds

    • Measure expression changes following ethylene treatment with time-course experiments

Research has established that CSLE2 acts downstream of OsEIL1-mediated ethylene signaling, with OsEIL1 directly activating CSLE1, 2, 7, 9. These methodologies will help characterize the precise molecular mechanisms and potentially identify additional regulatory factors involved in this pathway .

How should researchers interpret changes in CSLE2 expression in relation to cell wall phenotypes?

When analyzing CSLE2 expression data and corresponding cell wall changes:

  • Expression-phenotype correlation:

    • Establish temporal relationships between CSLE2 expression changes and observed cell wall modifications

    • Quantify cell wall thickness, xyloglucan content, and mechanical properties in relation to expression levels

    • Consider tissue-specific expression patterns when interpreting localized cell wall changes

  • Comparative analysis framework:

    • Compare expression profiles of multiple CSLE family members (CSLE1, 2, 7, 9, 10)

    • Correlate with changes in specific cell wall components (particularly xylose residues)

    • Assess root growth inhibition as a functional output of these molecular changes

  • Statistical approaches:

    • Use time-series analysis to capture dynamic relationships

    • Apply correlation analyses between gene expression and biochemical/phenotypic data

    • Implement principal component analysis to identify major patterns across multiple variables

Research indicates that ethylene treatment increases both CSLE2 expression and xylose residue content in wild-type rice roots but not in OsEIL1 mutants. This correlation supports a functional relationship between CSLE2 expression and specific changes in cell wall composition .

What considerations are important when analyzing contradictory data in CSLE2 research?

When faced with conflicting results in CSLE2 studies:

  • Methodological variations:

    • Different expression systems may yield proteins with varying activities

    • Cell wall extraction methods can significantly impact compositional analysis

    • Growth conditions and experimental timing affect hormone responses

  • Genetic background effects:

    • Rice subspecies and cultivar differences may influence CSLE2 function

    • Functional redundancy among CSLE family members can mask phenotypes in single mutants

    • Consider generating higher-order mutants to address redundancy

  • Tissue-specific functions:

    • CSLE2 may have different roles in various tissues (root epidermis vs. other cell types)

    • Whole-tissue analysis might obscure cell-type-specific effects

    • Use cell-type-specific promoters for more precise genetic manipulation

  • Environmental interactions:

    • Abiotic stress conditions may modify ethylene responses and CSLE2 function

    • Document all growth parameters and environmental conditions precisely

When analyzing contradictory findings, consider that CSLE2 functions within a complex network involving multiple CSLE and CESA genes, with potential compensation among family members that may produce variable results across different experimental systems .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.