Recombinant Oryza sativa subsp. japonica Cellulose synthase-like protein E6 (CSLE6)

Shipped with Ice Packs
In Stock

Description

Protein Identification and Function

CSLE6 (Gene: CSLE6; UniProt ID: Q651X6) is a Golgi-localized β-glycan synthase involved in polymerizing hemicellulose backbones, which contribute to plant cell wall integrity and water retention mechanisms during drought stress . Key functional attributes include:

  • Gene Locus: Chromosome 9 (18,321.214–18,315.154 kbp) .

  • Interactions: Forms complexes with proteins such as 4CLL9, CSLA3, and CSLA6, indicating a role in coordinated stress response networks .

  • Drought Tolerance: Co-expressed with drought-responsive proteins, suggesting its involvement in water retention systems under severe drought conditions .

Drought Stress Studies

  • CSLE6 overexpression and gene-editing experiments have linked it to enhanced water retention and cell wall remodeling under drought stress .

  • Interaction networks involving CSLE6 suggest cross-talk between cellulose synthesis and stress signaling pathways .

Gene Expression Analysis

  • CSLE6 expression is validated using RT-qPCR with reference genes like ACT2 and TUA2 in Elymus sibiricus, demonstrating its conserved role in stress responses .

Key Research Findings

  • Interaction Networks: CSLE6 interacts with proteins like PHYA and ERF26, linking cellulose synthesis to light signaling and transcriptional regulation .

  • Co-Expression: Under drought stress, CSLE6 co-localizes with cortical microtubules, suggesting microtubule-guided CSC (cellulose synthase complex) trafficking .

  • Phosphorylation: Red light modulates CSC activity via phosphorylation of CSLE6-associated proteins, influencing cellulose deposition patterns .

Future Directions

While CSLE6 is implicated in drought tolerance, its regulatory mechanisms and interactions with minor stress-response genes remain poorly understood . Further studies using recombinant CSLE6 could clarify its role in crop resilience and cell wall engineering.

Product Specs

Form
Lyophilized powder
Please note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them in your order notes. We will accommodate your request to the best of our ability.
Lead Time
Delivery time may vary depending on the purchase method and location. For specific delivery timelines, please consult your local distributor.
Note: All proteins are shipped with standard blue ice packs. If dry ice shipping is required, please inform us in advance. Additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For optimal preservation, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We advise adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%, which can serve as a reference.
Shelf Life
The shelf life is influenced by various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C, while the shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple use. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
Please note: The tag type will be determined during the production process. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
CSLE6; Os09g0478300; Os09g0478200; LOC_Os09g30130; P0556A05.32; Cellulose synthase-like protein E6; OsCslE6
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-728
Protein Length
full length protein
Species
Oryza sativa subsp. japonica (Rice)
Target Names
CSLE6
Target Protein Sequence
METTTTERRRLFATEKVGGRAVYRLQAATVAAGILLVLYYRATRVPAAGEGRAAWLGMAA AELWFAVYWVITQSVRWCPVRRRTFKNRLAERYKENLPGVDVFVCTADPHAEPPSLVIST ILSVMAYNYPSEKISVYLSDDGGSILTFYALWEASMFAKKWLPFCRRYNIEPRSPAAYFS ESEGHHNLCSPKEWSFIKNLYEEMRERIDSAVMSGKIPEEIKLKHKGFDEWNSEMTSKNH QPIVQVLIDGKSQNAVDDDGNVLPTLVYMAREKSPQYHHNFKAGALNALIRVSALISDSP VILNVDCDMYSNNSDSIRDALCFFLDEEMSHKIGFVQYPQNYNNMTKNNIYGNSLNVINH VEMRGLDSAGGCLYIGTGCFHRREILCGKKFSKDYKEDWGRGIKERGHENIDEIEEKAKS LATCTYELRTQWGNEIGVKYGCPVEDVITGLAIHCRGWESVYMEPQRAAFVGVAPATLAQ TILQHKRWSEGNFTIFLSKHNTFLFGHGKISLQLQMGYCIYGLWAANSLPTIYYVMIPAL GLVKGTPLFPEIMSPWATPFIYVFCVKTLYSLYEALLSGDTLKGWWNGQRMWMVKRITSY LYGFIDTIRKLLGLSKMSFEITAKVSDGDEAKRYEQEILEFGSSSPEFVIIATVALLNFV CLVAGLSKIMAGVWNVFLPQVILCGLIVITNIPIYEAMFVRKDKGRIPLPVTLASIGFVM LAFLLPIV
Uniprot No.

Target Background

Function
This protein is believed to function as a Golgi-localized beta-glycan synthase, responsible for polymerizing the backbones of noncellulosic polysaccharides (hemicelluloses) found in plant cell walls.
Database Links
Protein Families
Glycosyltransferase 2 family, Plant cellulose synthase-like E subfamily
Subcellular Location
Golgi apparatus membrane; Multi-pass membrane protein.

Q&A

What is the relationship between CSLE6 and other cellulose synthases in rice?

While both belong to the glycosyltransferase family, CSLE6 differs from cellulose synthase (CESA) proteins in several ways. Unlike CESA proteins that directly synthesize cellulose microfibrils, cellulose synthase-like proteins such as CSLE6 are believed to synthesize non-cellulosic polysaccharides in plant cell walls. Based on homology with other cellulose synthases, CSLE6 likely contains conserved catalytic motifs including DDG, DXD, TED, and QXXRW domains that are essential for glycosyltransferase activity . These domains coordinate UDP-glucose binding, chain elongation, and polysaccharide translocation. Comparative sequence analysis can reveal the evolutionary relationship and functional divergence between CSLE6 and other cell wall biosynthetic enzymes.

What expression systems are most effective for producing recombinant CSLE6?

Based on experiences with similar proteins, several expression systems can be employed for CSLE6 production, each with distinct advantages:

Expression SystemAdvantagesLimitationsOptimal Conditions
E. coliHigh yield, economical, rapidLimited post-translational modificationsN-terminal histidine tag, expression at 16-18°C
Insect cellsBetter folding of complex proteinsHigher cost, longer production timeBaculovirus expression vector system
Plant-based systemsNative post-translational modificationsLower yieldTransient expression in Nicotiana benthamiana

E. coli systems typically require optimization of induction conditions and solubilization strategies. For CSLE6, a recommended approach would be similar to that used for Ory s 1 protein, employing a histidine tag for purification and maintaining protein in buffer containing 50 mM Na₂HPO₄ (pH 7.4), 0.5 M NaCl, with appropriate detergent .

How should researchers design experiments to investigate CSLE6 function in vivo?

A comprehensive experimental design for CSLE6 functional analysis should include:

  • Gene knockdown/knockout approaches:

    • CRISPR-Cas9 mediated gene editing

    • RNAi-based suppression

    • T-DNA insertion mutant analysis

  • Complementation experiments:

    • Express wild-type CSLE6 in mutant background

    • Test different promoters (native vs. constitutive)

    • Include appropriate controls for each transformation experiment

  • Phenotypic characterization:

    • Cell wall composition analysis (crystalline cellulose content)

    • Growth measurements (hypocotyl length, root development)

    • Microscopic analysis of tissue morphology

  • Protein localization studies:

    • Fluorescent protein tagging (e.g., YFP-CSLE6)

    • Co-localization with organelle markers

    • Live-cell imaging using spinning-disk confocal microscopy

Experimental outcomes should be quantified using appropriate statistical methods, with minimum biological replicates (n≥3) and technical replicates to ensure reproducibility .

What are the critical controls needed for CSLE6 functional assays?

Proper controls are essential for reliable CSLE6 research results. Based on best practices in experimental design:

  • Negative controls:

    • Empty vector transformants

    • Catalytically inactive CSLE6 mutant (e.g., with mutations in DXD motif)

    • Wild-type plants without treatment

  • Positive controls:

    • Well-characterized related protein (e.g., CESA6)

    • Known cell wall synthesis inhibitor response

    • Recovery experiments after inhibition

  • Technical validation controls:

    • Single stain controls for fluorescence experiments

    • Instrument calibration standards

    • Inter-assay calibrators for quantitative measurements

  • Biological validation controls:

    • Multiple independent transgenic lines

    • Different tissue types and developmental stages

    • Environmental condition variations

The absence of single stain controls in fluorescence experiments is a significant red flag that can compromise data interpretation . Similarly, lacking proper negative controls makes it impossible to distinguish specific from non-specific effects in functional studies.

How do mutations in key catalytic motifs affect CSLE6 function and trafficking?

Based on studies of related cellulose synthases, mutations in conserved motifs of CSLE6 would likely produce specific functional consequences:

MotifMutation TypeExpected Functional EffectTrafficking Impact
DDGConservative (D to E)Reduced catalytic efficiencyMinimal effect on trafficking
DDGNon-conservative (D to N)Significant loss of activityIncreased Golgi retention
DXDAny substitutionDisrupted UDP-glucose coordinationAltered vesicle dynamics
TEDT to A/S substitutionAffected glucan chain elongationVariable effects
QXXRWR substitutionDisrupted glucan chain translocationDecreased abundance in Golgi

Mutation analysis enables structure-function mapping by correlating specific amino acid changes with alterations in enzymatic activity and cellular localization. For example, mutations in the DDG motif of CESA6 increase protein abundance in the Golgi apparatus, suggesting impaired trafficking to the plasma membrane . Similar effects might be expected for CSLE6 mutations, though the specific consequences should be experimentally determined.

How can researchers systematically analyze the effects of CSLE6 mutations?

A comprehensive mutation analysis workflow should include:

  • Rational design of mutations:

    • Target conserved catalytic motifs (DDG, DXD, TED, QXXRW)

    • Create both conservative and non-conservative substitutions

    • Design mutations based on homology modeling

  • Expression and localization analysis:

    • Quantify protein levels in different cellular compartments

    • Measure the speed of protein trafficking using kymograph analysis

    • Calculate the density of CSLE6 in Golgi, SmaCCs (small CESA compartments), and plasma membrane

  • Functional assessment:

    • Measure impact on cell wall composition

    • Analyze growth phenotypes in complementation studies

    • Determine effects on polysaccharide synthesis in vitro

  • Data integration:

    • Correlate mutation position with functional outcomes

    • Compare results with related proteins like CESA6

    • Develop predictive models of structure-function relationships

When performing mutation studies, it's essential to distinguish between effects on protein folding/stability versus direct effects on catalytic activity or trafficking .

What imaging techniques are most effective for studying CSLE6 dynamics?

Multiple complementary imaging approaches can reveal different aspects of CSLE6 biology:

  • Live-cell imaging techniques:

    • Spinning-disk confocal microscopy (SDCM) for high spatiotemporal resolution of CSLE6 movement

    • Variable-angle epifluorescence microscopy (VAEM) for plasma membrane dynamics

    • Photobleaching recovery (FRAP) to measure protein mobility

  • Image acquisition parameters:

    • Time-lapse intervals: 5-10 seconds for trafficking studies

    • Z-stack sampling: 0.2-0.5 μm steps for 3D localization

    • Laser power optimization to minimize photobleaching

  • Quantitative analysis methods:

    • Kymograph analysis for measuring protein motility speeds

    • Particle tracking for vesicle movement quantification

    • Colocalization analysis with organelle markers

  • Data interpretation frameworks:

    • Statistical comparison of wild-type vs. mutant dynamics

    • Correlation of movement parameters with functional outcomes

    • Integration with biochemical data

For optimal results, researchers should employ YFP or similar fluorescent protein tags positioned to minimize interference with CSLE6 function, and conduct imaging in actively growing tissues where cell wall synthesis is most active .

How can researchers effectively measure CSLE6 enzymatic activity?

Comprehensive enzymatic characterization of CSLE6 requires multiple complementary approaches:

  • In vitro activity assays:

    • Radioisotope incorporation using UDP-[14C]glucose

    • HPLC-based detection of substrate consumption

    • Mass spectrometric analysis of reaction products

  • Reaction optimization parameters:

    • Buffer composition: Tris-HCl (pH 7.5-8.0), divalent cations (Mg2+/Mn2+)

    • Temperature range: 25-30°C

    • Incubation time: 30 minutes to 4 hours

    • Detergent selection for membrane protein stability

  • Product characterization methods:

    • Linkage analysis by methylation followed by GC-MS

    • NMR spectroscopy for structural determination

    • Enzymatic digestion with specific glycosidases

  • Kinetic parameter determination:

    • Km and Vmax for UDP-glucose and other potential substrates

    • Inhibitor sensitivity profiles

    • pH and temperature optima

When performing these assays, researchers should be aware that recombinant protein expression conditions can significantly impact enzymatic activity, and multiple protein preparation methods may need to be tested .

How can researchers overcome common challenges in CSLE6 expression and purification?

Membrane proteins like CSLE6 present specific challenges that can be addressed through systematic optimization:

  • Expression optimization strategies:

    • Test multiple expression constructs with varying boundaries

    • Screen different fusion tags (His, MBP, GST, SUMO)

    • Optimize codon usage for expression host

    • Test expression at reduced temperatures (16-20°C)

  • Solubilization and purification approaches:

    • Detergent screening (DDM, LMNG, digitonin)

    • Lipid nanodisc incorporation for native-like environment

    • Two-step purification (affinity chromatography followed by size exclusion)

    • On-column detergent exchange

  • Stability enhancement methods:

    • Addition of glycerol (10-20%) to buffers

    • Inclusion of substrate or substrate analogs

    • Optimization of pH and ionic strength

    • Storage condition testing (-80°C, liquid nitrogen, with/without cryoprotectants)

  • Quality control checkpoints:

    • SDS-PAGE for purity assessment

    • Western blotting for identity confirmation

    • Size exclusion chromatography for aggregation analysis

    • Thermal shift assays for stability measurement

For consistent results, standardized protocols should be developed and followed, with careful documentation of all purification parameters .

How should researchers interpret contradictory results in CSLE6 studies?

When facing conflicting data, researchers should implement a systematic approach to resolution:

  • Methodological assessment:

    • Evaluate experimental design and control adequacy

    • Compare methodological details between contradictory studies

    • Consider differences in protein constructs, expression systems, or assay conditions

  • Technical validation approaches:

    • Replicate experiments with standardized protocols

    • Employ multiple independent methods to measure the same parameter

    • Consult with researchers using similar techniques

  • Biological context considerations:

    • Analyze tissue-specific or developmental differences

    • Evaluate genetic background effects

    • Consider environmental or stress-induced variations

  • Statistical analysis framework:

    • Apply appropriate statistical tests based on data distribution

    • Determine if conflicting results are statistically significant

    • Consider meta-analysis of multiple datasets

When reporting contradictory findings, researchers should explicitly discuss potential sources of variation and propose experiments to resolve discrepancies .

What emerging technologies have the greatest potential for advancing CSLE6 research?

Several cutting-edge approaches are poised to transform our understanding of CSLE6:

  • Structural biology techniques:

    • Cryo-electron microscopy for high-resolution structure determination

    • AlphaFold2 and related AI methods for structure prediction

    • Hydrogen-deuterium exchange mass spectrometry for conformational dynamics

  • Advanced imaging approaches:

    • Super-resolution microscopy (PALM/STORM) for nanoscale localization

    • Single-molecule tracking for detailed dynamics analysis

    • Correlative light and electron microscopy (CLEM)

  • Functional genomics tools:

    • CRISPR-based screens for functional partner identification

    • Proximity labeling (BioID, TurboID) for interactome mapping

    • Single-cell transcriptomics for expression pattern resolution

  • Biochemical innovations:

    • Cell-free expression systems for membrane protein production

    • Native mass spectrometry for complex composition analysis

    • Microfluidic approaches for high-throughput activity assays

The integration of these technologies with established methods will provide unprecedented insights into CSLE6 structure, function, and regulation in plant cell wall biosynthesis.

How can multi-omics approaches enhance our understanding of CSLE6 function?

Integrative strategies combining multiple data types can reveal complex aspects of CSLE6 biology:

  • Multi-omics data integration framework:

    • Transcriptomics: Expression patterns across tissues and conditions

    • Proteomics: Post-translational modifications and protein interactions

    • Metabolomics: Cell wall composition and metabolic flux analysis

    • Phenomics: Growth and development under various conditions

  • Data analysis and visualization methods:

    • Network analysis to identify functional associations

    • Pathway enrichment for biological context

    • Machine learning for pattern recognition

    • Interactive visualization tools for data exploration

  • Validation strategies:

    • Targeted experiments to test predictions from omics data

    • Genetic manipulation to confirm functional associations

    • Physiological assays to link molecular changes to plant phenotypes

  • Challenges and considerations:

    • Data normalization across different platforms

    • Statistical methods for multi-dimensional data

    • Computational requirements for integrated analysis

    • Biological interpretation of complex datasets

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.