Recombinant Oryza sativa subsp. japonica Chitin elicitor-binding protein (CEBIP)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder

Note: We will prioritize shipping the format currently in stock. However, if you require a specific format, please specify this in your order notes; we will accommodate your request to the best of our ability.

Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.

Note: All proteins are shipped with standard blue ice packs. Dry ice shipping is available upon request with an additional fee. Please contact us in advance to arrange this.

Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which may serve as a guideline for your use.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and the protein's inherent stability.
Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C. Lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.

The specific tag will be determined during production. If you require a particular tag type, please inform us, and we will prioritize its inclusion.

Synonyms
CEBIP; Os03g0133400; LOC_Os03g04110; OJ1006F06.19; OsJ_30068; Chitin elicitor-binding protein; CEBiP; OsCEBiP; Lysin motif-containing protein 1; Os-LYP1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
29-356
Protein Length
Full Length of Mature Protein
Species
Oryza sativa subsp. japonica (Rice)
Target Names
CEBIP
Target Protein Sequence
ANFTCAVASGTTCKSAILYTSPNATTYGNLVARFNTTTLPDLLGANGLPDGTLSSAPVAA NSTVKIPFRCRCNGDVGQSDRLPIYVVQPQDGLDAIARNVFNAFVTYQEIAAANNIPDPN KINVSQTLWIPLPCSCDKEEGSNVMHLAYSVGKGENTSAIAAKYGVTESTLLTRNKIDDP TKLQMGQILDVPLPVCRSSISDTSADHNLMLLPDGTYGFTAGNCIRCSCSSTTYQLNCTA VQNKGCPSVPLCNGTLKLGETNGTGCGSTTCAYSGYSNSSSLIIQTSLATNQTTACQRGG SGRSQFARSMWSMSVISFHMVLIIICFL
Uniprot No.

Target Background

Function

Chitin elicitor-binding protein involved in the perception and signal transduction of chitin oligosaccharide elicitor signals, mediating defense responses.

Database Links
Subcellular Location
Cell membrane; Single-pass membrane protein.
Tissue Specificity
Expressed in seedlings, roots, shoots, stems and flowers.

Q&A

What is the molecular structure of CEBiP in Oryza sativa and how does it differ from other plant pattern recognition receptors?

CEBiP is a plasma membrane glycoprotein that functions as a cell surface receptor specifically detecting chitin oligosaccharides from fungal cell walls. Unlike many other pattern recognition receptors, CEBiP contains two extracellular LysM motifs and a transmembrane domain but lacks any obvious intracellular domains for signal transduction . This structural characteristic indicates that CEBiP requires additional components to transmit signals across the plasma membrane into the cytoplasm. This contrasts with CERK1 (Chitin elicitor receptor kinase 1), which contains three LysM motifs in its extracellular domain and possesses an intracellular Ser/Thr kinase domain with autophosphorylation activity . The receptor complex typically involves both CEBiP and OsCERK1 to create a functional signaling unit in rice.

How do researchers distinguish between CEBiP and CERK1 functionality in chitin perception systems?

Researchers differentiate between CEBiP and CERK1 functions through multiple experimental approaches:

  • Binding assays: CEBiP specifically binds chitin oligosaccharides, especially longer chains (heptamer-octamer), while CERK1 demonstrates different binding characteristics .

  • Knockout/knockdown studies: CEBiP knockdown transformants show suppression of chitin-induced defense responses in rice, while CERK1 knockout mutants in Arabidopsis completely lose ability to respond to chitin elicitors including MAPK activation, reactive oxygen species generation, and defense gene expression .

  • Domain-swapping experiments: These reveal that the central lysine motif in CEBiP's ectodomain is essential for binding chitin oligosaccharides .

  • Receptor complex analysis: CEBiP lacks intracellular signaling domains, whereas CERK1 contains a functional kinase domain, indicating they play complementary roles in the receptor complex .

What molecular features determine CEBiP's binding specificity to chitin oligosaccharides?

The binding specificity of CEBiP to chitin oligosaccharides is determined by several key molecular features:

  • Central LysM domain: Deletion and domain-swapping experiments demonstrate that the central lysine motif in CEBiP's ectodomain is essential for binding chitin oligosaccharides .

  • Chain length preference: NMR spectroscopic epitope mapping indicates preferential binding of longer-chain chitin oligosaccharides, particularly heptamers and octamers, to CEBiP .

  • N-acetyl group recognition: The N-acetyl groups of chitin oligosaccharides are critical for binding, as revealed through NMR spectroscopy studies .

  • Key amino acid residues: Molecular modeling and docking studies identified Ile122 in the central lysine motif region as particularly important for ligand binding, which was confirmed through site-directed mutagenesis .

  • Binding orientation: Two CEBiP molecules can simultaneously bind to one N-acetylchitoheptaose/octaose molecule from opposite sides, facilitating receptor dimerization .

What methods are most effective for determining the three-dimensional structure of recombinant CEBiP, and what challenges exist?

Effective methods for determining CEBiP's three-dimensional structure include:

Key challenges researchers face include:

  • Expressing functional glycosylated recombinant CEBiP that maintains native folding

  • Maintaining protein stability during purification

  • Capturing dynamic conformational changes during ligand binding

  • Determining the complete receptor complex structure including CEBiP-CERK1 interactions

How does CEBiP cooperate with CERK1 to initiate immune signaling in response to chitin perception?

CEBiP and CERK1 form a functional receptor complex that initiates immune signaling through a coordinated process:

  • Initial recognition: CEBiP specifically binds chitin oligosaccharides through its LysM domains .

  • Receptor dimerization: Upon chitin binding, two CEBiP molecules bind simultaneously to one chitin oligosaccharide (heptamer/octamer) from opposite sides, causing receptor dimerization .

  • Complex formation: The CEBiP-chitin complex associates with CERK1, which contains intracellular kinase domains capable of signal transduction .

  • Signal transduction: CERK1's intracellular Ser/Thr kinase domain undergoes autophosphorylation and initiates downstream signaling cascades through phosphorylation events .

  • Defense activation: This signaling triggers MAP kinase activation, reactive oxygen species generation, and defense gene expression that contribute to fungal resistance .

The complementary functions of these proteins are evident as CEBiP provides primary chitin recognition, while CERK1 contributes the necessary signaling capacity to activate immune responses. Their coordinated action represents a sophisticated two-component receptor system for fungal PAMP detection.

What experimental approaches best demonstrate the bifunctional role of OsCERK1 in both immunity and symbiosis?

The bifunctional role of OsCERK1 in mediating both chitin-triggered immunity and symbiotic relationships with arbuscular mycorrhizal (AM) fungi can be demonstrated through several experimental approaches:

  • Gene knockout/knockdown studies: Analyzing phenotypes of OsCERK1 mutants in both pathogen challenge and AM fungal colonization contexts. OsCERK1 has been shown to be required for the perception of short-chain chitin oligomers in arbuscular mycorrhizal signaling .

  • Ligand binding assays: Demonstrating that OsCERK1 binds to both chitin hexamer ((NAG)6) and tetramer ((NAG)4) directly, as shown through crystal structure determination of the OsCERK1-(NAG)6 complex at 2 Å resolution .

  • Structural analysis: Studies have revealed that upon recognition, chitin hexamer binds OsCERK1 by interacting with the shallow groove on the surface of LysM2, with mutational analyses demonstrating that LysM2 is crucial for recognition of both (NAG)6 and (NAG)4 .

  • Differential gene expression analysis: Comparing transcriptomic changes in wild-type vs. OsCERK1-deficient plants during both pathogen infection and AM fungal colonization.

  • Biochemical pathway analysis: Identifying different downstream components activated by OsCERK1 during immune response versus symbiotic signaling.

These approaches collectively demonstrate how a single receptor protein can discriminate between pathogenic and beneficial fungi, leading to distinct physiological outcomes.

What expression systems provide optimal yield and functionality for recombinant CEBiP production?

Several expression systems can be used for recombinant CEBiP production, each with advantages and limitations:

  • Pichia pastoris expression system:

    • Advantages: Post-translational modifications including glycosylation, high yield, secretion capability

    • Example: Successfully used to express related proteins like MoCel12A and MoCel12B fused to 6×His epitopes

    • Typical yield: 5-20 mg/L of culture

  • Escherichia coli expression system:

    • Advantages: Rapid growth, simple media requirements, high yield

    • Limitations: Lacks proper glycosylation, potential for misfolding of plant receptors

    • Best for: Expressing individual domains rather than full-length CEBiP

  • Plant-based expression systems (e.g., Nicotiana benthamiana):

    • Advantages: Proper plant-specific post-translational modifications

    • Limitations: Lower yield, technically demanding

    • Best for: Functional studies requiring native modifications

  • Insect cell expression (Baculovirus):

    • Advantages: Higher eukaryotic system with post-translational modifications

    • Successfully used for related receptor proteins

    • Typical yield: 1-5 mg/L culture

Optimal protocol parameters for P. pastoris expression of recombinant CEBiP:

  • Codon optimization for P. pastoris

  • Alpha factor secretion signal

  • Induction with 0.5% methanol at 25°C for 72 hours

  • Purification using Ni-NTA affinity chromatography followed by size exclusion chromatography

How can researchers effectively verify both the binding activity and signaling function of recombinant CEBiP?

To comprehensively verify both binding activity and signaling function of recombinant CEBiP, researchers should employ a multi-faceted approach:

  • Binding activity verification:

    • Isothermal titration calorimetry (ITC): Measures binding affinity and thermodynamic parameters of CEBiP-chitin interactions

    • Surface plasmon resonance (SPR): Determines real-time binding kinetics and affinity constants

    • NMR spectroscopy: Provides epitope mapping as demonstrated in previous studies

    • Microscale thermophoresis: Measures interactions in solution with minimal sample consumption

  • Functional verification:

    • Complementation assays: Expressing recombinant CEBiP in CEBiP-knockout/knockdown plants to restore chitin responsiveness

    • Cell-based reporter assays: Measuring activation of defense-responsive promoters

    • Co-immunoprecipitation: Verifying interaction with CERK1 and formation of functional receptor complexes

    • MAPK activation assays: Demonstrating the ability to trigger downstream signaling events

  • Structural integrity verification:

    • Circular dichroism spectroscopy: Confirms proper secondary structure

    • Limited proteolysis: Assesses proper folding

    • Glycosylation analysis: Verifies proper post-translational modifications

    • Size exclusion chromatography: Ensures proper oligomeric state

A complete verification protocol should include controls with mutated versions of CEBiP (e.g., mutations in the Ile122 residue identified as critical for binding) and comparison with native CEBiP isolated from rice.

How does the identification of CEBiP-CERK1 receptor complex influence strategies for engineering broad-spectrum fungal resistance in crops?

The detailed understanding of the CEBiP-CERK1 receptor complex offers several strategic approaches for engineering enhanced fungal resistance:

  • Receptor overexpression: Increased expression of CEBiP and/or CERK1 can enhance sensitivity to fungal chitin, potentially accelerating and strengthening defense responses. This approach must balance immune activation with potential growth penalties.

  • Engineering optimized receptor variants: Based on structural insights showing how chitin hexamer binds OsCERK1 through the shallow groove on LysM2 , researchers can engineer receptors with enhanced binding affinity or broader recognition specificity.

  • Manipulating receptor complex formation: Since two CEBiP molecules bind simultaneously to one chitin oligosaccharide from opposite sides , engineering pre-formed receptor dimers could potentially enhance sensitivity to low concentrations of fungal PAMPs.

  • Cross-species receptor transfer: Transferring optimized chitin perception systems between monocots and dicots could confer novel recognition capabilities, as the chitin perception mechanisms appear to be conserved but with species-specific variations.

  • Balancing immunity and symbiosis: Engineering must consider OsCERK1's bifunctional role in both immunity and arbuscular mycorrhizal symbiosis , potentially creating variants that maintain beneficial fungal interactions while enhancing pathogen resistance.

Experimental evidence shows that proper modulation of these receptors can enhance resistance to fungal pathogens without severely compromising plant growth or beneficial mycorrhizal relationships, making this a promising approach for sustainable crop protection.

What recent methodological advances have improved our understanding of the structural interface between CEBiP and chitin oligosaccharides?

Recent methodological advances have significantly enhanced our understanding of the CEBiP-chitin interface:

  • Cryo-electron microscopy: Has enabled visualization of receptor complexes in near-native states, revealing previously uncharacterized conformational changes upon ligand binding.

  • Advanced NMR techniques: Saturation transfer difference NMR spectroscopy has been particularly valuable for epitope mapping, identifying precisely which portions of chitin oligosaccharides interact with CEBiP binding sites .

  • Molecular dynamics simulations: Have provided insights into the dynamic nature of receptor-ligand interactions over time, complementing static crystallographic data.

  • Hydrogen-deuterium exchange mass spectrometry: Reveals conformational changes and solvent accessibility alterations upon ligand binding.

  • Site-directed mutagenesis coupled with functional assays: Has confirmed the importance of specific residues like Ile122 in the central lysine motif region for ligand binding .

  • X-ray crystallography of related complexes: The determination of the OsCERK1-(NAG)6 complex structure at 2 Å resolution has provided valuable insights into chitin recognition mechanisms .

  • Computational modeling/docking approaches: These have clarified molecular interactions between receptors and chitin oligosaccharides, predicting binding orientations and energetics .

These methodological advances collectively support a model where CEBiP preferentially binds longer-chain chitin oligosaccharides (heptamers/octamers) through its central LysM domain, with N-acetyl groups playing a critical role in recognition, ultimately leading to receptor dimerization as a key step in immune signaling initiation.

How does the chitin perception system in rice compare with similar systems in other plant species?

The chitin perception systems show both conservation and diversity across plant species:

Plant SpeciesPrimary Chitin ReceptorsKey Structural FeaturesSpecificityDownstream Signaling
Rice (O. sativa)CEBiP and OsCERK1CEBiP: 2 LysM motifs, no kinase domain; OsCERK1: 3 LysM motifs, kinase domainPreferential binding to longer-chain chitin oligosaccharides (heptamer-octamer)MAPK cascades, ROS production, defense gene activation
Arabidopsis (A. thaliana)AtCERK1, LYK4, LYK5AtCERK1: 3 LysM motifs, kinase domain; LYK5: higher chitin binding affinity than CERK1Recognition of various chitin oligomersMAPK activation, ROS generation, defense gene expression
Wheat (T. aestivum)Similar to rice systemContains CEBiP-like and CERK1-like proteinsSimilar to riceSimilar to rice
LegumesHave additional LysM-RLKs involved in both chitin perception and Nod factor recognitionLysM-RLKs with dual recognition capabilityDiscriminate between similar LysM-containing moleculesCan trigger either defense or symbiotic signaling

Key distinctions:

  • Rice uses a two-component system (CEBiP/OsCERK1) where CEBiP is the primary binding protein

  • Arabidopsis depends more heavily on CERK1 and related LysM-RLKs (LYK4/LYK5)

  • OsCERK1 plays dual roles in immunity and symbiosis , while this bifunctionality varies in other species

  • The structural basis for chitin binding has species-specific features, although the core LysM-mediated recognition is conserved

These comparisons reveal evolutionary adaptations in chitin perception systems that reflect different ecological niches and pathogen pressures while maintaining the fundamental ability to recognize this critical fungal PAMP.

What are the most promising future research directions for understanding CEBiP-mediated immunity?

Several promising research directions will likely advance our understanding of CEBiP-mediated immunity:

  • Receptor complex dynamics: Investigating the temporal and spatial dynamics of CEBiP-CERK1 complex formation in living cells using advanced imaging techniques like single-molecule tracking and super-resolution microscopy.

  • Structural biology of the complete receptor complex: Determining the three-dimensional structure of the entire CEBiP-CERK1-chitin complex, particularly focusing on conformational changes that occur during signaling initiation.

  • Signaling specificity mechanisms: Elucidating how OsCERK1 differentiates between pathogenic and symbiotic signals to trigger appropriate downstream responses, particularly focusing on the molecular switch between immunity and symbiosis .

  • Integration with other immune pathways: Understanding how CEBiP-mediated chitin signaling integrates with other immune pathways, including those triggered by intracellular receptors, to create a comprehensive immune response.

  • Evolutionary adaptation of chitin perception: Comparing chitin perception systems across diverse plant species to understand evolutionary adaptations to different fungal pathogens and symbionts.

  • Microbe counter-strategies: Investigating how fungal pathogens evade or suppress CEBiP-mediated immunity, potentially by secreting effectors that target this receptor system.

  • Synthetic biology approaches: Engineering optimized chitin perception systems with enhanced sensitivity or specificity based on structural insights, such as the importance of the LysM2 domain and specific residues like Ile122 .

These research directions will contribute to a more comprehensive understanding of plant-fungal interactions and potentially lead to novel strategies for crop protection against fungal diseases while preserving beneficial symbiotic relationships.

What are the most common challenges in working with recombinant CEBiP and how can they be addressed?

Researchers commonly encounter several challenges when working with recombinant CEBiP:

  • Low expression yields:

    • Challenge: Membrane proteins like CEBiP often express poorly in heterologous systems

    • Solution: Optimize codon usage for expression host; use stronger promoters; test multiple expression hosts (P. pastoris often performs better than E. coli for plant receptors); consider fusion tags that enhance solubility

  • Improper folding/lack of activity:

    • Challenge: Recombinant CEBiP may not fold correctly or lack glycosylation

    • Solution: Express in eukaryotic systems that provide proper post-translational modifications; include chaperones; optimize purification conditions to prevent denaturation; validate activity using binding assays with known chitin ligands

  • Aggregation during purification:

    • Challenge: Membrane proteins tend to aggregate when removed from membranes

    • Solution: Use mild detergents like DDM or LMNG; include stabilizing agents; perform purification at lower temperatures; consider nanodiscs or other membrane mimetics for stable reconstitution

  • Verification of functionality:

    • Challenge: Confirming that recombinant CEBiP maintains native activity

    • Solution: Develop robust binding assays using isothermal titration calorimetry or surface plasmon resonance; perform complementation assays in knockout/knockdown plant lines; verify interaction with known partners like CERK1

  • Stability during storage:

    • Challenge: Recombinant CEBiP may lose activity during storage

    • Solution: Optimize buffer conditions (pH, salt concentration, glycerol); flash-freeze aliquots; avoid repeated freeze-thaw cycles; consider lyophilization for long-term storage

How can researchers effectively distinguish between CEBiP-specific and CERK1-specific contributions to chitin-induced immunity?

Distinguishing between CEBiP and CERK1 contributions requires sophisticated experimental approaches:

  • Genetic separation using mutants and complementation:

    • Generate single and double knockout/knockdown lines for CEBiP and CERK1

    • Perform systematic complementation with wild-type or mutated versions

    • Compare phenotypes in response to chitin treatment or fungal challenge

    • Example approach: CERK1 knockout mutants in Arabidopsis completely lose ability to respond to chitin elicitor

  • Domain-specific mutational analysis:

    • Create targeted mutations in specific domains (e.g., LysM domains) of each protein

    • Evaluate the impact on binding, complex formation, and signaling

    • Focus particularly on the LysM2 domain in CERK1, which has been shown to be crucial for chitin recognition

  • Biochemical separation of functions:

    • Compare direct binding affinities of purified receptors to different chitin oligosaccharides

    • Assess kinase activity of CERK1 in the presence/absence of CEBiP and chitin

    • Use in vitro reconstitution of receptor complexes to study requirements for signaling

  • Temporal analysis of receptor activation:

    • Examine the sequence of events following chitin perception

    • Monitor receptor complex formation, phosphorylation events, and downstream signaling

    • Determine whether certain responses depend specifically on CEBiP, CERK1, or their interaction

  • Ligand specificity comparison:

    • Test receptor responses to different chitin oligosaccharide lengths and derivatives

    • Compare recognition patterns between CEBiP (preferring longer chains) and CERK1

    • Use chemical biology approaches with modified ligands to probe specific interactions

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.