Recombinant Oryza sativa subsp. japonica Chlorophyll a-b binding protein 2, chloroplastic (CAB2R)

Shipped with Ice Packs
In Stock

Description

Introduction

Recombinant Oryza sativa subsp. japonica Chlorophyll a-b binding protein 2, chloroplastic (CAB2R) is a protein that, in Oryza sativa (rice), is encoded by the gene CAB2R . CAB2R is a component of the light-harvesting complex (LHC), which captures and delivers excitation energy to photosystems in plants .

Basic Information

Oryza sativa subsp. japonica Chlorophyll a-b binding protein 2, chloroplastic(CAB2R) is also known as LHCP or Chlorophyll a-b binding protein 2, chloroplastic . The protein encoded by the CAB2R gene is a full length protein consisting of 30-261 amino acids .

Function and Structure

CAB2R functions as a light receptor, capturing and delivering excitation energy to photosystems . CAB2R is a member of the chlorophyll a-b binding protein family, which are essential for photosynthesis . These proteins bind chlorophyll and carotenoid molecules, which are responsible for absorbing light energy.

CAB2R is located in the chloroplast, the organelle where photosynthesis takes place . Specifically, it is found in the thylakoid membranes, which are internal membranes within the chloroplast that contain the photosystems and light-harvesting complexes.

Expression and Localization

CAB2R is expressed in Oryza sativa subsp. japonica (rice) . The protein is specifically targeted to the chloroplast, where it functions in the light-harvesting complex .

Research and Applications

CAB2R is a well-studied protein due to its importance in photosynthesis. Research on CAB2R and other chlorophyll a-b binding proteins has focused on understanding the structure and function of the light-harvesting complex, as well as the regulation of photosynthesis . This research has implications for improving crop yields and developing new sources of renewable energy.

Data Tables

FeatureDescription
Protein NameChlorophyll a-b binding protein 2, chloroplastic
Alternative NamesLHCII type I CAB-2, LHCP
Gene NameCAB2R
Ordered Locus NamesOs01g0600900, LOC_Os01g41710
OrganismOryza sativa subsp. japonica (Rice)
FunctionLight receptor, captures and delivers excitation energy to photosystems
LocationChloroplast, thylakoid membranes
AA SequenceRKSAAKPKPAASGSPWYGADRVLYLGPLSGEPPSYLTGEFPGDYGWDTAGLSADPETFAK NRELEVIHSRWAmLGALGCVFPELLARNGVKFGEAVWFKAGSQIFSEGGLDYLGNPSLIH AQSILAIWAVQVVLMGAVEGYRIAGGPLGEVVDPLYPGGSFDPLGLADDPEAFAELKVKE IKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK (full length protein)

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a guideline for your preparation.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is finalized during production. If a specific tag type is required, please inform us; we will prioritize its development.
Synonyms
CAB2R; Os01g0600900; LOC_Os01g41710; OsJ_28992; P0518F01.17-1; Chlorophyll a-b binding protein 2, chloroplastic; LHCII type I CAB-2; LHCP
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
30-261
Protein Length
Full Length of Mature Protein
Species
Oryza sativa subsp. japonica (Rice)
Target Names
CAB2R
Target Protein Sequence
RKSAAKPKPAASGSPWYGADRVLYLGPLSGEPPSYLTGEFPGDYGWDTAGLSADPETFAK NRELEVIHSRWAMLGALGCVFPELLARNGVKFGEAVWFKAGSQIFSEGGLDYLGNPSLIH AQSILAIWAVQVVLMGAVEGYRIAGGPLGEVVDPLYPGGSFDPLGLADDPEAFAELKVKE IKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK
Uniprot No.

Target Background

Function

The light-harvesting complex (LHC) serves as a light receptor, capturing and transferring excitation energy to associated photosystems.

Database Links
Protein Families
Light-harvesting chlorophyll a/b-binding (LHC) protein family
Subcellular Location
Plastid, chloroplast thylakoid membrane; Multi-pass membrane protein.

Q&A

What is the structural composition of Chlorophyll a-b binding protein in rice?

Chlorophyll a-b binding protein in Oryza sativa subsp. japonica (Rice) is a chloroplastic protein that belongs to the LHCII type I CAB family (also abbreviated as LHCP) . The protein contains several conserved domains essential for chlorophyll binding and energy transfer. The amino acid sequence reveals a highly conserved structure with multiple membrane-spanning regions that anchor the protein within the thylakoid membrane. The full sequence of the related RCABP89 protein (263 amino acids) includes specific regions responsible for pigment binding and protein-protein interactions that facilitate the assembly of the light-harvesting complex .

The protein's tertiary structure features multiple alpha-helical transmembrane domains that coordinate chlorophyll molecules and carotenoids in precise orientations to maximize light absorption efficiency and energy transfer to photosystems. Spectroscopic analyses have demonstrated that each protein monomer can bind approximately 8-14 chlorophyll molecules and 3-4 carotenoid molecules, arranged to optimize excitation energy transfer.

What are the genomic characteristics of the Chlorophyll a-b binding protein gene in rice?

The gene encoding Chlorophyll a-b binding protein in Oryza sativa subsp. japonica has been mapped to chromosome 3, with the specific locus designation Os03g0592500 (LOC_Os03g39610) . The gene contains multiple exons and introns, with a coding region that spans approximately 789 base pairs (263 amino acids × 3 bp). The expression region has been identified between positions 36-263 of the protein sequence .

The gene belongs to a multigene family with several members exhibiting tissue-specific expression patterns. Genomic analyses have revealed that CAB genes in rice have undergone multiple duplication events during evolution, resulting in subfunctionalization of some family members. The expression of these genes is tightly regulated by light, developmental cues, and various environmental factors.

How does the function of Chlorophyll a-b binding protein relate to photosynthetic efficiency in rice?

In rice, the expression levels of CAB proteins have been correlated with photosynthetic rates under various environmental conditions. Studies have demonstrated that plants with optimized CAB protein levels show enhanced photosynthetic efficiency, particularly under fluctuating light conditions. The precise arrangement of chlorophyll molecules within the protein structure enables efficient excitation energy transfer while minimizing energy loss through non-photochemical quenching mechanisms.

What expression systems are most effective for producing recombinant Chlorophyll a-b binding protein?

The expression of recombinant CAB proteins presents unique challenges due to their membrane-associated nature and requirement for cofactor binding. Several expression systems have been developed with varying degrees of success:

  • Plant-based expression systems: Transgenic rice cell suspension cultures have been successfully employed for recombinant protein production . This system offers the advantage of native post-translational modifications and appropriate cellular machinery for proper protein folding. The rice alpha amylase 3D (RAmy3D) promoter system has been particularly effective, as it allows metabolic regulation of protein expression .

  • Bacterial expression systems: E. coli-based expression systems using chromosome engineering techniques can be employed for CAB protein production . This approach utilizes a defective λ prophage system that supplies functions to protect and recombine electroporated linear DNA in bacterial cells . The temperature-dependent repressor allows tight control of prophage expression by shifting cultures to 42°C for 15 minutes .

A methodological comparison of expression systems reveals:

Expression SystemAdvantagesLimitationsTypical Yield
Rice Cell CultureNative folding, PTMsSlow growth (6-7 days)Moderate (1-5 mg/L)
E. coliRapid growth, high yieldLimited PTMs, inclusion bodiesHigh (5-50 mg/L)
Insect CellsEukaryotic PTMsComplex media, higher costModerate (2-10 mg/L)
Cell-FreeRapid, membrane proteinsScalability issues, costLow (0.1-1 mg/L)

The choice of expression system depends on the specific research objectives and downstream applications of the recombinant protein.

What are the optimal conditions for induction and expression in plant-based systems?

For plant-based expression systems, particularly rice cell suspension cultures under the control of the RAmy3D promoter, specific cultivation conditions have been established to maximize recombinant protein production:

  • Growth phase optimization: Transgenic rice cells should be grown to mid-to-late exponential growth phase (approximately 6-7 days) before induction .

  • Sugar regulation: The RAmy3D promoter is suppressed in sugar-rich environments but activated under sugar-starved conditions . Therefore, cells are initially grown in sugar-rich medium for biomass production, followed by a medium exchange to sugar-free medium to induce protein expression .

  • Post-induction cultivation: Following the medium exchange, an additional 4-5 days of cultivation is typically required for optimal protein expression .

  • Temperature and light conditions: Maintaining cultures at 25-28°C with appropriate light cycles (16h light/8h dark) enhances photosynthetic protein expression.

  • Aeration and agitation: Proper aeration through controlled agitation (100-120 rpm) ensures adequate oxygen supply while minimizing shear stress.

These conditions must be carefully monitored and optimized for each specific construct and cell line to achieve maximum protein yields while maintaining protein functionality.

How can recombination techniques be applied to optimize Chlorophyll a-b binding protein expression?

Recombination-based approaches offer powerful tools for optimizing the expression of recombinant CAB proteins. The λ prophage recombination system provides an efficient method for chromosome engineering in expression hosts like E. coli :

  • Linear DNA substrate design: PCR primers can be designed with 5' ends homologous to flanking regions of the target DNA and 3' ends that prime the cassette DNA for replication . This generates a linear DNA product with the expression cassette flanked by target homology.

  • Electroporation protocol: Purified linear donor DNA (1-100 ng) is mixed with competent cells and electroporated using specific parameters (1.8 kV, 25 μF with Pulse controller of 200 ohms) . This allows the recombination machinery to integrate the expression construct into the host genome.

  • Post-electroporation recovery: Electroporated cells are immediately diluted with growth medium and either incubated for 1-2 hours at 32°C or spread on sterile filters and incubated before selection .

  • Confirmation of recombinants: Successful recombination events can be confirmed through altered phenotypes, PCR analysis, Southern hybridization, and sequencing .

This recombination approach eliminates the requirement for standard cloning as all novel joints are engineered by chemical synthesis in vitro and efficiently recombined into place in vivo . The technology is simple and straightforward, with recombination functions being transiently supplied by shifting cultures to 42°C for 15 minutes .

What purification strategies yield the highest purity and activity of recombinant Chlorophyll a-b binding protein?

Purification of recombinant CAB proteins requires specialized approaches due to their membrane-associated nature and pigment-binding properties:

  • Membrane extraction: Initial isolation involves careful extraction from thylakoid membranes using mild detergents (typically 0.5-1% n-dodecyl-β-D-maltoside or Triton X-100) that maintain protein structure while effectively solubilizing the membrane components.

  • Chromatographic separation: Multi-step chromatography approaches yield the highest purity:

    • Immobilized metal affinity chromatography (IMAC) using histidine-tagged constructs

    • Ion exchange chromatography exploiting the protein's natural charge distribution

    • Size exclusion chromatography as a final polishing step to achieve homogeneity

  • Pigment reconstitution: For full functionality, purified protein often requires reconstitution with chlorophyll a, chlorophyll b, and carotenoid pigments under controlled conditions.

  • Buffer optimization: Storage in optimized buffers containing 50% glycerol and Tris-based components at -20°C or -80°C maintains stability, though repeated freeze-thaw cycles should be avoided .

To evaluate purification success, analytical methods including SDS-PAGE, spectroscopic analysis (absorption spectra from 350-700 nm), and circular dichroism can confirm structural integrity and pigment binding capacity. For short-term experiments, working aliquots can be maintained at 4°C for up to one week .

How can researchers assess the functional integrity of recombinant Chlorophyll a-b binding protein?

Multiple complementary approaches are required to comprehensively evaluate the functional integrity of recombinant CAB proteins:

  • Spectroscopic analysis: Absorption, fluorescence, and circular dichroism spectroscopy provide essential information about pigment binding and protein folding. Properly folded CAB proteins exhibit characteristic absorption peaks at approximately 440 nm and 675 nm (chlorophyll a) and 460 nm and 650 nm (chlorophyll b).

  • Energy transfer efficiency: Time-resolved fluorescence measurements can determine the efficiency of excitation energy transfer between chlorophyll b and chlorophyll a molecules, a critical functional parameter that typically exceeds 90% in native protein complexes.

  • Thermal stability assays: Differential scanning calorimetry or fluorescence-based thermal shift assays can assess protein stability and the impact of mutations or expression conditions on structural integrity.

  • Reconstitution into liposomes: Functional assays involving the incorporation of purified protein into artificial membrane systems allow measurement of energy transfer to associated photosystem components.

  • Single-molecule fluorescence spectroscopy: Advanced imaging techniques can reveal conformational dynamics and energy transfer pathways within individual protein complexes.

A combination of these approaches provides a comprehensive assessment of whether recombinant CAB proteins maintain native-like structure and function.

What analytical methods best characterize the pigment-binding properties of the recombinant protein?

The precise characterization of pigment-binding properties is essential for understanding CAB protein function:

  • High-performance liquid chromatography (HPLC): Pigment extraction followed by HPLC analysis with photodiode array detection allows quantification of the types and amounts of bound pigments. Typical chlorophyll a:b ratios in functional CAB proteins range from 1.2:1 to 1.4:1.

  • Resonance Raman spectroscopy: This technique provides detailed information about pigment-protein interactions by analyzing vibrational modes of bound chlorophylls and carotenoids. Specific frequency shifts indicate the strength and nature of interactions between pigments and protein residues.

  • Circular dichroism (CD) spectroscopy: CD in the visible region reveals the excitonic coupling between chlorophyll molecules, which is highly sensitive to their relative orientation and distance.

  • Mass spectrometry approaches: Native mass spectrometry and hydrogen-deuterium exchange mass spectrometry can map the binding sites and dynamics of pigment-protein interactions.

  • Computational modeling: Molecular dynamics simulations using the protein sequence data can predict pigment binding sites and energetics of interactions, guiding experimental design and interpretation.

These methods collectively provide a detailed understanding of how recombinant CAB proteins coordinate pigment molecules and how sequence variations affect these critical interactions.

How can recombinant Chlorophyll a-b binding protein be utilized in photosynthesis enhancement studies?

Recombinant CAB proteins serve as valuable tools for investigating strategies to enhance photosynthetic efficiency:

  • Structure-function relationship studies: Site-directed mutagenesis of specific amino acid residues in the recombinant protein allows researchers to identify critical regions for pigment binding and energy transfer. The amino acid sequence provided for RCABP89 can guide targeted mutagenesis experiments.

  • Antenna size optimization: Manipulating the expression levels of recombinant CAB proteins can alter the light-harvesting antenna size, potentially reducing photoinhibition under high light conditions while maintaining efficient light capture under limiting light.

  • Spectral tuning: Engineering CAB proteins with modified pigment-binding properties can expand the spectral range of light absorption, potentially increasing photosynthetic efficiency in specific light environments.

  • Protein stability enhancement: Introducing stabilizing mutations can improve protein performance under stress conditions, contributing to more robust photosynthetic machinery.

  • Synthetic biology approaches: Recombinant CAB proteins can be incorporated into artificial photosynthetic systems or modified organisms with redesigned photosynthetic apparatus for improved efficiency.

These applications require precise control of expression systems, such as the RAmy3D promoter-based system described for rice cell cultures , which allows regulated production of the recombinant protein under specific conditions.

What experimental designs best address the effects of environmental stressors on Chlorophyll a-b binding protein functionality?

To investigate environmental stress effects on CAB protein functionality, researchers can implement multi-factorial experimental designs:

  • Controlled environment studies:

    • Temperature stress: Expose plants or recombinant proteins to temperature gradients (10-45°C) and analyze changes in protein stability, pigment binding, and energy transfer efficiency

    • Light stress: Compare functionality under varying light intensities and spectral compositions

    • Drought/salinity stress: Examine effects of osmotic potential on protein-pigment interactions

  • Time-course analyses: Monitor dynamic changes in CAB protein abundance, post-translational modifications, and assembly into complexes during stress progression and recovery phases.

  • Comparative studies: Analyze differences between wild-type and engineered CAB proteins under identical stress conditions to identify critical residues for stress tolerance.

  • Omics integration: Combine proteomics, transcriptomics, and metabolomics data to create comprehensive models of stress responses involving CAB proteins.

Experimental controls should include carefully matched growth conditions prior to stress application, with statistical designs incorporating sufficient biological and technical replication (minimum n=4) to account for biological variability.

How can researchers integrate recombinant Chlorophyll a-b binding protein studies with broader photosynthetic research?

The integration of CAB protein research with broader photosynthetic studies requires multidisciplinary approaches:

  • Systems biology frameworks: Position CAB protein research within broader photosynthetic networks by combining protein-level studies with transcriptome, metabolome, and physiological measurements.

  • Cross-species comparative analyses: Compare rice CAB proteins with homologs from other plant species to identify conserved functional elements and species-specific adaptations.

  • Synthetic biology approaches: Incorporate recombinant CAB proteins into minimal synthetic systems to identify essential components for efficient light harvesting.

  • Computational modeling: Develop multi-scale models that connect molecular-level energy transfer processes within CAB proteins to leaf-level and canopy-level photosynthetic productivity.

  • Climate change research integration: Assess how CAB protein functionality might respond to predicted future climate scenarios, particularly elevated CO₂, temperature, and altered precipitation patterns.

The recombination technology described for E. coli provides a versatile platform for generating variants for these integrative studies, as it allows efficient chromosome engineering through simple and straightforward manipulations .

What are common challenges in recombinant Chlorophyll a-b binding protein expression and how can they be addressed?

Researchers frequently encounter several challenges when expressing recombinant CAB proteins:

  • Low expression yields:

    • Challenge: Membrane proteins often express poorly in heterologous systems

    • Solution: Optimize codon usage for the expression host, use strong inducible promoters like RAmy3D , and test multiple signal peptides for proper targeting

  • Protein misfolding and aggregation:

    • Challenge: Without proper chaperone assistance, CAB proteins may form insoluble aggregates

    • Solution: Co-express molecular chaperones, use lower induction temperatures (16-20°C), and add stabilizing agents like glycerol to the culture medium

  • Inefficient pigment incorporation:

    • Challenge: Recombinant systems may lack sufficient chlorophyll synthesis

    • Solution: Supplement expression media with chlorophyll precursors or perform in vitro reconstitution with purified pigments

  • Proteolytic degradation:

    • Challenge: Misfolded membrane proteins are often targeted for degradation

    • Solution: Include protease inhibitors during purification, use protease-deficient host strains, and optimize extraction conditions

  • Growth inhibition of host cells:

    • Challenge: Overexpression may stress host cells, particularly with the 6-7 day growth period required for rice cell cultures

    • Solution: Use tightly regulated promoters like the temperature-dependent system described for E. coli , optimize induction timing, and use cell lines with higher stress tolerance

Maintaining precise control of expression timing is critical, as demonstrated by the RAmy3D promoter system that requires 4-5 days post-induction for optimal protein expression .

How can researchers troubleshoot issues with protein folding and stability?

Ensuring proper folding and stability of recombinant CAB proteins requires systematic troubleshooting:

  • Spectroscopic assessment of folding:

    • Monitor absorption spectra (400-700 nm) during purification steps

    • Properly folded protein shows characteristic chlorophyll absorption peaks

    • Misfolded protein exhibits spectral shifts and reduced extinction coefficients

  • Detergent optimization matrix:

    • Test multiple detergent types (maltoside, glucoside, and non-ionic detergents)

    • Vary detergent concentrations (0.01-1%) to identify optimal solubilization conditions

    • Consider detergent mixtures for improved stability

  • Thermal stability enhancement:

    • Screen buffer additives (glycerol, sucrose, specific lipids) using thermal shift assays

    • Test pH ranges (pH 6.0-8.0) to identify optimal stability conditions

    • Include specific lipids that interact with the protein in its native environment

  • Storage condition optimization:

    • Follow recommended storage conditions (-20°C for regular use, -80°C for extended storage)

    • Use 50% glycerol in Tris-based buffer as indicated for related proteins

    • Avoid repeated freeze-thaw cycles as they significantly impact stability

  • Limited proteolysis analysis:

    • Use controlled proteolytic digestion to identify flexible or improperly folded regions

    • Compare digestion patterns between active and inactive protein preparations

    • Redesign constructs based on identified stable domains

These troubleshooting approaches should be applied systematically, with careful documentation of conditions and outcomes to build a comprehensive understanding of the factors affecting protein stability.

What emerging technologies might advance research on Chlorophyll a-b binding proteins?

Several cutting-edge technologies show particular promise for advancing CAB protein research:

  • Cryo-electron microscopy (Cryo-EM): Recent advances in single-particle cryo-EM resolution now allow detailed structural analysis of membrane protein complexes in near-native environments. This technology can reveal dynamic states of CAB proteins that have been inaccessible through traditional crystallography.

  • Single-molecule techniques: Techniques such as single-molecule FRET and high-speed AFM provide unprecedented insights into the dynamic behavior of individual protein complexes, revealing conformational changes during energy transfer events.

  • Advanced gene editing: CRISPR-Cas9 technology allows precise modification of CAB genes in their native genomic context, enabling studies of protein function without the limitations of heterologous expression systems.

  • Artificial intelligence approaches: Machine learning algorithms can now predict protein-pigment interactions and engineer optimized CAB proteins with enhanced stability or modified spectral properties.

  • Advanced recombination technologies: The λ prophage recombination system described for E. coli represents a class of efficient chromosome engineering techniques that can be further developed for creating precise modifications in expression systems.

These emerging technologies will likely enable researchers to address longstanding questions about the dynamic behavior of CAB proteins during energy transfer and their adaptations to changing environmental conditions.

How might structure-guided protein engineering improve CAB protein functionality?

Structure-guided protein engineering offers promising approaches to enhance CAB protein functionality:

  • Enhanced spectral sensitivity: Targeted modifications of pigment-binding residues can alter the absorption properties of bound chlorophylls, potentially extending the spectral range of photosynthetically active radiation.

  • Improved thermal stability: Computational design of additional stabilizing interactions (salt bridges, hydrogen bonds) can enhance protein stability under stress conditions without compromising function.

  • Optimized energy transfer pathways: Strategic placement of chlorophyll molecules through residue modifications can create more efficient pathways for excitation energy transfer, reducing energy losses.

  • Reduced photoinhibition: Engineering specific amino acid changes in the protein structure can enhance photoprotection mechanisms, potentially reducing damage under high light conditions.

  • Novel binding sites for synthetic chromophores: Creating binding sites for non-natural pigments could extend light absorption into new spectral regions.

The amino acid sequence of related proteins like RCABP89 provides a foundation for identifying conserved functional regions that could be targeted for specific modifications while maintaining core functionality.

What quality control parameters should be implemented when working with recombinant Chlorophyll a-b binding proteins?

Rigorous quality control is essential when working with recombinant CAB proteins:

Quality Control ParameterAcceptable RangeMethodology
Purity>95%SDS-PAGE, SEC-MALS
Chlorophyll a:b ratio1.2:1 to 1.4:1HPLC analysis
Absorption spectrumPeaks at 440, 675 nmUV-Vis spectroscopy
Fluorescence yield>80% of native proteinSteady-state fluorescence
Energy transfer efficiency>90%Time-resolved fluorescence
Thermal stabilityTm > 45°CDifferential scanning calorimetry
Oligomeric stateDefined assembliesNative PAGE, analytical SEC
Pigment stoichiometry8-14 Chl per proteinQuantitative pigment analysis

Additionally, researchers should regularly verify protein identity through mass spectrometry and N-terminal sequencing, particularly when using different expression systems or constructs. For rice-based expression systems, the cultivation timeframes described (6-7 days for growth phase, 4-5 days post-induction) should be closely monitored as deviations can significantly impact protein quality.

What standardized protocols best enable cross-laboratory reproducibility in CAB protein research?

Standardized protocols are critical for reproducible research across different laboratories:

  • Expression system standardization:

    • Detailed documentation of host strain genotype and growth conditions

    • Precise control of induction parameters (temperature shifts to 42°C for 15 minutes in the λ prophage system)

    • Standardized media composition with defined component sources

  • Purification protocol reporting:

    • Complete documentation of buffer compositions, column types, and flow rates

    • Specific detergent concentrations and purification temperatures

    • Detailed chromatography gradients and fraction selection criteria

  • Analytical method standardization:

    • Calibrated spectrophotometric measurements with defined pathlength and instrument settings

    • Reference standards for pigment quantification

    • Consistent protein concentration determination methods

  • Data reporting requirements:

    • Raw data availability through repositories

    • Detailed experimental methods sections with no omitted parameters

    • Statistical analysis plans defined before experimentation

  • Material sharing practices:

    • Deposition of expression constructs in public repositories

    • Detailed protocols for transferring the defective prophage to other strains

    • Verification methods for received materials

Implementation of these standardized protocols would significantly enhance reproducibility across laboratories and accelerate progress in CAB protein research.

What are the most promising research directions for Chlorophyll a-b binding protein studies?

The field of CAB protein research offers several promising directions for future investigation:

These research directions build upon the fundamental knowledge of protein structure, expression systems, and functional characteristics described in the literature while pushing toward applications that address global challenges in agriculture and energy production.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.