Recombinant Oryza sativa subsp. japonica Chloroplast envelope membrane protein (cemA)

Shipped with Ice Packs
In Stock

Description

Production and Purification

The recombinant cemA protein is typically produced in E. coli with an N-terminal His tag for affinity purification. Key production parameters include:

ParameterDetailsSource
Expression SystemE. coli (BL21(DE3) or similar strains).
TagHis tag for nickel affinity chromatography.
Purity>90% as determined by SDS-PAGE.
StorageLyophilized or glycerol-stabilized aliquots at -20°C/-80°C.

While specific data for Oryza sativa cemA is limited, its production aligns with protocols for homologues in Zygnema circumcarinatum and Barbarea verna .

Functional Insights from Homologues

Studies on cemA homologues provide indirect evidence of its role:

CO₂ Transport in Cyanobacteria

In Synechocystis, the cotA gene (cemA homologue) is essential for CO₂ uptake. Mutants lacking functional cotA show impaired growth under low-CO₂ conditions, suggesting cemA’s role in maintaining carbon-concentrating mechanisms .

Membrane Targeting in Plants

In maize, cemA ribosomes remain predominantly soluble during translation, unlike thylakoid-targeted proteins. This implies post-translational integration into the inner envelope membrane, possibly mediated by a novel Sec translocase .

Applications in Research

ApplicationDetailsSource
Carbon Fixation StudiesUsed to study CO₂ diffusion and proton gradients in chloroplasts.
Membrane BiogenesisInvestigates inner envelope protein sorting mechanisms.
Structural BiologyELISA and zymographic assays to analyze binding activity and enzymatic properties.

Challenges and Future Directions

  1. Functional Elucidation: Direct experimental evidence for Oryza sativa cemA’s role in proton transport remains limited.

  2. Proteolytic Sensitivity: Recombinant cemA’s susceptibility to cleavage necessitates optimized storage and handling .

  3. Evolutionary Conservation: Comparative studies across plant species could reveal conserved motifs critical for function.

References

  1. Creative Biomart. (2025). Recombinant Zygnema circumcarinatum Chloroplast Envelope Membrane Protein (cemA).

  2. Dongxiang wild rice genome analysis. PMC. 2022.

  3. Chlamydomonas reinhardtii atpA gene cluster. PMC. 2016.

  4. Spontaneous cleavages in recombinant CenA. PMC. 2021.

  5. Thylakoid-bound ribosomes in maize. PMC. 2015.

  6. CEMA cationic peptide patents. Google Patents. 1996.

  7. ELISA for Zea mays cemA. Colorectal Research.

  8. cotA homologue in cyanobacteria. PNAS. 1996.

  9. Barbarea verna cemA. Creative Biomart. 2025.

  10. MyBioSource. cemA recombinant protein.

  11. Biocompare. Recombinant cemA from MyBioSource.

  12. cotA essential for CO₂ transport. PNAS. 1996.

  13. CD Biosciences. Oryza sativa cemA. 2024.

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them when placing your order, and we will fulfill them as best as possible.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributors for specific delivery timeframes.
Note: All of our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial prior to opening to ensure the contents settle at the bottom. Please reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer composition, storage temperature, and the intrinsic stability of the protein.
Generally, liquid forms have a shelf life of 6 months at -20°C/-80°C. Lyophilized forms have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have specific tag type requirements, please inform us, and we will prioritize developing the specified tag.
Synonyms
cemA; ycf10; LOC_Osp1g00470; Chloroplast envelope membrane protein
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-230
Protein Length
full length protein
Species
Oryza sativa subsp. japonica (Rice)
Target Names
cemA
Target Protein Sequence
MKKKKALPSFLYLVFIVLLPWGVSFSFNKCLELWIKNWWNTRQSQTLLTAIQEKRVLERF MELEDLFILDEMIKEKPNTHVQNPPIGIRKEIIQLAKIDNEGHLHIILHFSTNIICLAIL SGSFFLGKEELVILNSWVQEFFYNLNDSVKAFFILLVTDFFVGFHSTRGWELLIRWVYND LGWVPNELIFTIFVCSFPVILDTCLKFWVFFCLNRLSPSLVVIYHSISEA
Uniprot No.

Target Background

Function
May be involved in proton extrusion. Indirectly promotes efficient inorganic carbon uptake into chloroplasts.
Database Links
Protein Families
Cema family
Subcellular Location
Plastid, chloroplast inner membrane; Multi-pass membrane protein.

Q&A

What is cemA and what is its primary function in rice chloroplasts?

The chloroplast envelope membrane protein A (cemA) is a plastid-encoded protein essential for chloroplast development and function in Oryza sativa subsp. japonica (rice). It plays a crucial role in chloroplast biogenesis and is involved in the regulation of chloroplast gene expression. Similar to other chloroplast proteins, cemA is integrated into the complex regulatory network that coordinates plastid and nuclear gene expression to complete the biosynthesis and assembly of functional chloroplasts .

How is cemA localized within rice chloroplasts?

The cemA protein is primarily localized to the chloroplast envelope membrane, as suggested by its name. To confirm this localization experimentally, researchers typically use subcellular localization techniques such as:

  • Fusion protein approaches: The cemA coding sequence can be fused with a reporter gene (such as GFP) and transiently expressed in rice protoplasts to visualize its localization.

  • Immunogold labeling: Using cemA-specific antibodies coupled with gold particles for transmission electron microscopy visualization.

  • Chloroplast fractionation: Separating the envelope, thylakoid, and stromal fractions followed by immunoblotting.

Similar to other chloroplast proteins like YL4, proper subcellular localization is critical for cemA function. As observed with YL4, subcellular localization studies have revealed that these proteins are specifically localized to chloroplasts, confirming their role in chloroplast development .

What expression patterns does cemA exhibit across different rice tissues?

The expression of cemA, like other chloroplast development-related genes, shows tissue-specific patterns. Based on studies of similar chloroplast proteins in rice:

  • Highest expression is typically observed in photosynthetically active tissues, particularly leaves at various developmental stages

  • Expression is minimal or undetectable in non-photosynthetic tissues such as roots and stems

  • Expression patterns may vary throughout plant development stages

For example, research on the YL4 gene (another chloroplast-related protein) showed that "YL4 transcripts were highly expressed in all leaves and undetectable in roots and stems" . Similar expression patterns would be expected for cemA, given its role in chloroplast function.

How do environmental factors influence cemA expression in rice?

Environmental factors significantly impact cemA expression due to its role in chloroplast function. Researchers investigating cemA regulation should consider:

  • Light intensity and quality: Photosynthesis-related genes typically respond to changes in light conditions

  • Temperature stress: Both high and low temperature can alter chloroplast development and associated gene expression

  • Nutrient availability: Particularly nitrogen and iron status which affect chloroplast biogenesis

  • Water stress: Drought conditions can impact chloroplast membrane integrity and function

CRM domain proteins, which share functional similarities with cemA, have been shown to be integral to responses to abiotic stress . Experimental approaches to study these effects include qRT-PCR analysis under controlled stress conditions, RNA-seq analysis of stressed plants, and proteomic studies to evaluate post-translational regulation.

What are the optimal methods for cloning and expressing recombinant cemA protein?

For successful cloning and expression of recombinant cemA from rice, researchers should consider the following methodological approach:

  • Gene amplification:

    • Design primers based on the annotated cemA sequence from Oryza sativa subsp. japonica

    • Use high-fidelity polymerase for PCR amplification from genomic DNA or cDNA

    • Consider codon optimization if expressing in heterologous systems

  • Expression systems:

    • Prokaryotic systems: E. coli BL21(DE3) with pET vectors for high yield

    • Eukaryotic systems: Yeast or insect cells for protein that requires eukaryotic post-translational modifications

    • Plant-based expression: Transient expression in Nicotiana benthamiana for plant-specific modifications

  • Purification strategy:

    • Add affinity tags (His, GST, or MBP) to facilitate purification

    • Include proper detergents for membrane protein solubilization

    • Employ size exclusion chromatography for final purification step

When designing primers, researchers can use approaches similar to those employed in the CRISPR/Cas9 targeting of YL4, where specific primers were designed using dedicated tools such as the CRISPR Primer Designer .

What are the most effective approaches for studying cemA knockouts in rice?

To study cemA function through knockout approaches, researchers should consider these methodological guidelines:

This approach follows similar methodologies to those used for YL4 gene characterization, where CRISPR/Cas9 genome editing was employed to confirm gene function, and subsequent phenotypic and transcriptional analyses were conducted .

What techniques are recommended for analyzing cemA protein-protein interactions?

For investigating cemA protein-protein interactions, researchers should employ multiple complementary techniques:

  • Yeast two-hybrid (Y2H) screening:

    • Use cemA as bait against a rice cDNA library

    • Verify positive interactions through selective media and reporter gene activation

    • Confirm specificity with appropriate controls and domain mapping

  • Co-immunoprecipitation (Co-IP):

    • Generate specific antibodies against cemA or use tagged versions

    • Isolate chloroplast fractions to enrich for relevant interactions

    • Identify co-precipitated proteins using mass spectrometry

  • Bimolecular fluorescence complementation (BiFC):

    • Fuse cemA and candidate interactors with split fluorescent protein fragments

    • Express in rice protoplasts or Nicotiana benthamiana leaves

    • Visualize interactions through confocal microscopy

  • In vitro pull-down assays:

    • Express recombinant cemA with affinity tags

    • Incubate with rice chloroplast extracts

    • Identify binding partners through mass spectrometry

These approaches would help elucidate the functional network of cemA, similar to how other chloroplast proteins have been characterized in terms of their interactions with splicing factors, ribosomal components, and other chloroplast proteins .

How does cemA contribute to chloroplast development in rice?

CemA contributes to chloroplast development through several mechanisms:

  • RNA processing and ribosome maturation:

    • May participate in the splicing of intron-containing chloroplast genes

    • Similar to CRM domain proteins that regulate intron splicing in chloroplast genes

    • Potentially involved in ribosome assembly for chloroplast translation

  • Chloroplast gene expression:

    • Likely influences the transcription or translation of chloroplast-encoded genes

    • May affect the function of plastid-encoded polymerase (PEP) and nuclear-encoded polymerase (NEP)

    • Contributes to coordinated expression of nuclear and plastid genes

  • Structural development:

    • Assists in the proper formation of thylakoid membranes

    • Contributes to the assembly of photosynthetic complexes

    • Impacts chlorophyll biosynthesis pathways

Mutations in cemA would likely result in phenotypes similar to those observed in the yl4 mutant, which showed "yellow-green leaves at all the stages, had fewer tillers, and had a decreased plant height" due to disrupted chloroplast development .

How can researchers quantify the impact of cemA mutations on photosynthetic efficiency?

To assess the impact of cemA mutations on photosynthetic efficiency, researchers should employ multiple measurement approaches:

Similar approaches would be used to those that revealed how YL4 mutation "affected transcript levels of genes involved in chloroplast development" leading to "delayed chloroplast development" .

What bioinformatic approaches should be used to analyze cemA conservation across rice subspecies?

For comprehensive bioinformatic analysis of cemA conservation, researchers should implement:

  • Sequence alignment and phylogenetic analysis:

    • Multiple sequence alignment using MUSCLE or CLUSTALW

    • Phylogenetic tree construction using Maximum Likelihood or Bayesian methods

    • Visualization of conservation using Jalview or WebLogo

  • Structural prediction and analysis:

    • Protein secondary structure prediction using PSIPRED

    • 3D structure modeling using homology modeling or AlphaFold2

    • Functional domain prediction and conservation assessment

  • Selection pressure analysis:

    • Calculate dN/dS ratios to identify selection signatures

    • Identify conserved vs. variable regions that may indicate functional constraints

    • Compare with other chloroplast proteins to identify evolutionary patterns

  • Comparative genomics:

    • Utilize whole-genome resequencing data from diverse rice varieties

    • Identify InDel variations following methods similar to those used for developing InDel markers in rice varieties

    • Compare indica and japonica subspecies to identify subspecies-specific variations

This approach would leverage techniques similar to those used in the "whole-genome variation analyses" of Oryza sativa subspecies, which have proven valuable for "genetic studies and to investigate the tropical japonica rice varieties" .

How do cemA mutations affect rice agronomic traits under field conditions?

To comprehensively evaluate the impact of cemA mutations on agronomic traits, researchers should consider:

  • Field trial design:

    • Randomized complete block design with adequate replication

    • Multiple environments to assess genotype × environment interactions

    • Control and stress conditions to evaluate performance under various scenarios

  • Agronomic trait measurements:

    Trait CategorySpecific Measurements
    Growth parametersPlant height, tiller number, leaf color, biomass
    Reproductive traitsDays to heading, panicle number, spikelet fertility
    Yield componentsGrain number, 1000-grain weight, yield per plant
    Quality traitsGrain shape, amylose content, protein content
  • Statistical analysis:

    • ANOVA to determine significant differences

    • Correlation analysis to identify relationships between traits

    • Path coefficient analysis to understand direct and indirect effects

    • Multivariate analysis to comprehensively evaluate trait relationships

  • Physiological measurements:

    • Chlorophyll content at different growth stages

    • Photosynthetic parameters under field conditions

    • Stress tolerance indicators (e.g., ROS levels, antioxidant enzyme activities)

These approaches align with findings that mutations in chloroplast-related genes like YL4 not only affect chloroplast development but also impact "some agronomic traits" including tillering and plant height .

What methodologies should be used to study the interaction between cemA and abiotic stress responses?

To investigate cemA's role in abiotic stress responses, researchers should employ these methodological approaches:

  • Stress treatment experiments:

    • Controlled environment studies with precise stress applications

    • Gradual vs. sudden stress exposure comparisons

    • Multiple stress intensities to determine threshold responses

    • Combined stresses to mimic field conditions

  • Gene expression analysis:

    • Time-course expression profiling of cemA under various stresses

    • RNA-seq to identify stress-responsive co-expressed genes

    • ChIP-seq to identify transcription factors regulating cemA expression

    • Promoter analysis to identify stress-responsive elements

  • Protein analysis:

    • Post-translational modification assessment under stress conditions

    • Protein stability and turnover rate determination

    • Protein localization changes in response to stress

    • Protein-protein interaction network alterations

  • Phenotypic evaluation:

    • Comparison of wild-type and cemA mutant responses to stresses

    • Recovery capacity assessment after stress removal

    • Transgenic overexpression studies to evaluate enhanced stress tolerance

    • Field evaluation under natural stress conditions

This approach builds on knowledge that CRM domain proteins, which share functional similarities with cemA, are "integral to ribosome development and response to abiotic stress" in plants .

What are the common challenges in purifying functional recombinant cemA protein and how can they be addressed?

Researchers frequently encounter several challenges when purifying recombinant cemA protein:

  • Protein solubility issues:

    • Challenge: As a membrane protein, cemA tends to form inclusion bodies

    • Solution: Optimize expression temperature (16-20°C), use solubility-enhancing tags (MBP, SUMO), or employ specialized detergents (n-dodecyl-β-D-maltoside, digitonin)

  • Low expression yield:

    • Challenge: Membrane proteins often express poorly in heterologous systems

    • Solution: Optimize codon usage for expression system, use strong inducible promoters, or explore cell-free expression systems

  • Protein functionality preservation:

    • Challenge: Maintaining native conformation and activity during purification

    • Solution: Incorporate lipids during purification, use mild detergents, and validate function through activity assays

  • Protein stability:

    • Challenge: Purified membrane proteins tend to aggregate over time

    • Solution: Identify optimal buffer conditions through thermal shift assays, add stabilizing agents (glycerol, specific lipids), and store in small aliquots

These approaches build on established methodologies for membrane protein purification and would be essential for obtaining functional cemA protein for subsequent biochemical and structural studies.

How should researchers interpret contradictory results regarding cemA function in different experimental systems?

When faced with contradictory results regarding cemA function, researchers should systematically analyze potential sources of discrepancy:

  • Experimental system differences:

    • Compare homologous vs. heterologous expression systems

    • Evaluate differences between in vitro and in vivo approaches

    • Consider strain/cultivar-specific genetic backgrounds

  • Methodological variations:

    • Critically compare experimental protocols and conditions

    • Assess sensitivity and specificity of detection methods

    • Evaluate statistical approaches and sample sizes

  • Integration strategy:

    • Perform meta-analysis of available data when possible

    • Design experiments that directly address contradictions

    • Develop mathematical models that can account for apparent contradictions

  • Validation approaches:

    • Use multiple independent techniques to confirm key findings

    • Employ both gain-of-function and loss-of-function approaches

    • Validate in different genetic backgrounds and environmental conditions

This systematic approach to resolving contradictions follows methodological principles similar to those used in confirming gene function through complementary techniques, as demonstrated in studies of other chloroplast proteins .

What emerging technologies hold promise for advancing our understanding of cemA function in rice?

Several cutting-edge technologies are poised to enhance our understanding of cemA:

  • CRISPR-based technologies:

    • Base editing for precise nucleotide changes without double-strand breaks

    • Prime editing for targeted insertions and deletions

    • CRISPRi/CRISPRa for reversible gene expression modulation

    • CRISPR screens for systematic functional analysis

  • Advanced imaging techniques:

    • Super-resolution microscopy for visualizing subcellular localization

    • Live-cell imaging to track protein dynamics in real-time

    • Correlative light and electron microscopy (CLEM) for structural-functional analysis

    • Label-free imaging techniques to observe native proteins

  • Single-cell technologies:

    • Single-cell RNA-seq for cell-specific expression patterns

    • Single-cell proteomics for protein-level analysis

    • Spatial transcriptomics to map expression in tissue context

  • Structural biology approaches:

    • Cryo-EM for membrane protein structure determination

    • Hydrogen-deuterium exchange mass spectrometry for protein dynamics

    • Integrative structural biology combining multiple data sources

These technologies would build upon established methodologies like CRISPR/Cas9 genome editing that has already proven valuable for characterizing chloroplast-related genes in rice .

How might cemA research contribute to improving rice adaptation to climate change?

Research on cemA has significant potential to contribute to climate adaptation strategies for rice:

  • Temperature stress tolerance:

    • Understanding cemA's role in chloroplast stability under heat/cold stress

    • Identifying genetic variations associated with improved temperature tolerance

    • Developing molecular markers for breeding temperature-resilient varieties

  • Drought resistance mechanisms:

    • Elucidating cemA's contribution to photosynthetic efficiency under water limitation

    • Investigating how cemA influences water use efficiency through chloroplast function

    • Developing drought-tolerant rice through targeted cemA modifications

  • Enhanced photosynthetic efficiency:

    • Optimizing cemA function for improved carbon fixation rates

    • Reducing photorespiration losses through strategic cemA engineering

    • Improving radiation use efficiency under fluctuating light conditions

  • Nutrient use efficiency:

    • Understanding cemA's role in chloroplast function under nutrient limitation

    • Enhancing nitrogen utilization through optimized photosynthetic machinery

    • Improving phosphorus use efficiency through enhanced energy metabolism

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.