Recombinant Oryza sativa subsp. japonica COBRA-like protein 2 (BC1L2)

Shipped with Ice Packs
In Stock

Description

Introduction to BC1L2

Recombinant Oryza sativa subsp. japonica COBRA-like protein 2 (BC1L2) is a bioengineered protein derived from the japonica subspecies of rice (Oryza sativa). It belongs to the COBRA (COBRA-like) protein family, which plays critical roles in plant cell wall development, particularly in secondary cell wall biosynthesis and structural integrity . BC1L2 is expressed in Escherichia coli as a recombinant fusion protein with an N-terminal His-tag, enabling efficient purification via affinity chromatography .

Expression System

BC1L2 is produced in E. coli using standard recombinant protein expression workflows:

  1. Cloning: The BC1L2 gene is inserted into an expression vector with a His-tag coding sequence.

  2. Induction: Bacterial cultures are induced to express the recombinant protein.

  3. Purification: Affinity chromatography (via His-tag) followed by lyophilization .

Optimization Considerations

  • Codon Usage: Rare codons in the N-terminal region may influence translation efficiency, though synonymous substitutions (e.g., TISigner) can improve yield .

  • Solubility: Lyophilized BC1L2 is reconstituted in sterile water (0.1–1.0 mg/mL) with optional glycerol (5–50%) for stability .

Potential Biotechnological Uses

ApplicationRationale
Plant BreedingEnhancing stem strength in crops via CRISPR-mediated gene editing .
BiomaterialsEngineering cellulose-based materials using COBRA-like proteins.
Structural BiologyStudying cell wall polysaccharide interactions (e.g., cellulose-lignin).

BC1L2 vs. BC1

FeatureBC1L2BC1 (Homolog)
Gene LocusOs03g0416300 Os01g0180100
Expression PatternNot reported; inferred from homologsVascular bundles, sclerenchyma
FunctionPutative role in cell wall biosynthesisConfirmed role in cellulose deposition

Mechanistic Challenges

  • In Vivo Validation: Direct evidence for BC1L2’s role in rice cell wall development remains uncharacterized.

  • Protein Interactions: No reported interactions with cellulose synthases or lignin-related enzymes, unlike BC1 .

Product Specs

Form
Lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice shipping is requested in advance. Additional fees apply for dry ice shipping.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a reference.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer components, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
If you require a specific tag type, please inform us; we will prioritize its development.
Synonyms
BC1L2; Os03g0416300; LOC_Os03g30260; OsJ_11271; OSJNBb0059G13.19; COBRA-like protein 2; Protein BRITTLE CULM1-like 2
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
30-458
Protein Length
Full Length of Mature Protein
Species
Oryza sativa subsp. japonica (Rice)
Target Names
BC1L2
Target Protein Sequence
YDPLDPNGNITIKWDITQWTPDGYVAVVTIYNFQKYRHIQAPGWSLGWAWAKKEIIWSMA GGQATEQGDCSAFKANIPHCCKRDPRVVDLVPGAPYNMQFGNCCKGGVLTSWVQDPLNAV ASFQITVGHSGTSNKTVKAPKNFTLKAPGPGYSCGLAQEVKPPTRFISLDGRRTTQAHVT WNVTCTYSQFVAQRAPTCCVSLSSFYNETIVNCPKCACGCQNKKPGSCVEGNSPYLASVV NGPGKGSLTPLVQCTPHMCPIRVHWHVKLNYRDYWRVKVTITNWNYRMNYSQWNLVVQHP NFENVSTVFSFNYKSLNPYGVINDTAMMWGVKYYNDLLMVAGPDGNVQSELLFRKDRSTF TFDKGWAFPRRIYFNGESCVMPSPDLYPWLPPSSTPRFRTVFLLMSFLVCGTLAFLHNHL VLDKNCGKC
Uniprot No.

Target Background

Database Links

KEGG: osa:4333115

UniGene: Os.50763

Protein Families
COBRA family
Subcellular Location
Membrane; Single-pass membrane protein.

Q&A

What is the biological function of COBRA-like protein 2 (BC1L2) in Oryza sativa subsp. japonica?

COBRA-like proteins, including BC1L2, are implicated in the regulation of cellulose biosynthesis and deposition in plant cell walls. In rice (Oryza sativa), BC1L2 is primarily expressed in developing sclerenchyma cells and vascular bundles, where it contributes to the mechanical strength of the plant by influencing secondary cell wall composition . Studies have shown that mutations in BC1L2 can lead to significant changes in cell wall properties, such as reduced cellulose content and altered lignin levels, which affect the plant's structural integrity .

The BC1L2 protein is thought to interact with cellulose synthase complexes or other components of the cell wall biosynthesis machinery, facilitating proper cellulose microfibril orientation. This role is analogous to that observed in Arabidopsis COBRA proteins, which are essential for oriented cell expansion .

How does recombinant BC1L2 differ from its native counterpart in rice?

Recombinant BC1L2 proteins are typically expressed in heterologous systems such as E. coli or yeast, allowing for controlled production and purification. These recombinant proteins often include affinity tags (e.g., His-tags) to facilitate purification and may lack certain post-translational modifications present in native plant proteins . For example, glycosylation patterns critical for protein folding or stability in planta might be absent or altered in recombinant systems.

Expression Systems

Heterologous expression systems such as E. coli, yeast (Saccharomyces cerevisiae), or insect cells are commonly used for producing recombinant BC1L2. Each system offers distinct advantages:

  • E. coli: Rapid growth and high yield but limited post-translational modifications.

  • Yeast: Provides eukaryotic folding machinery and some glycosylation.

  • Insect cells: Closely mimic plant-specific post-translational modifications.

Functional Assays

Functional studies often involve complementation assays using bc1 mutants of rice or related species. These assays test whether recombinant BC1L2 can restore normal phenotypes, such as cellulose content or mechanical strength .

Biochemical Techniques

Techniques such as SDS-PAGE for purity analysis, circular dichroism for secondary structure determination, and binding assays for interaction studies are essential for characterizing BC1L2's biochemical properties .

What are the key challenges in purifying recombinant BC1L2?

Purification of recombinant BC1L2 presents several challenges due to its structural properties and potential aggregation tendencies:

  • Solubility: Recombinant BC1L2 may form inclusion bodies when expressed in E. coli. Solubilization requires denaturants like urea or guanidine hydrochloride, followed by refolding protocols.

  • Stability: The protein's stability can be enhanced by optimizing buffer conditions (e.g., pH 8.0 with trehalose) and adding stabilizers like glycerol .

  • Purity: Achieving >90% purity often involves affinity chromatography (e.g., His-tag purification) followed by size-exclusion chromatography to remove aggregates .

How does BC1L2 influence cellulose biosynthesis?

BC1L2 plays a critical role in regulating cellulose biosynthesis by affecting the orientation and deposition of cellulose microfibrils within the secondary cell wall matrix . Mutations in BC1L2 lead to:

  • Reduced crystalline cellulose content (~70% of wild-type levels) .

  • Altered monosaccharide composition, with decreased glucose and increased xylose/arabinose levels .

  • Irregular cell wall morphology, characterized by thinner sclerenchyma walls and uneven deposition patterns .

These findings suggest that BC1L2 interacts with cellulose synthase complexes or modulates their activity indirectly through cell wall signaling pathways.

What methods can be used to analyze the structural properties of BC1L2?

Structural characterization of BC1L2 involves a combination of computational and experimental approaches:

  • Bioinformatics: Sequence alignment tools identify conserved domains related to cellulose-binding or GPI-anchor attachment.

  • Circular Dichroism (CD): Measures secondary structure content (e.g., alpha-helices, beta-sheets).

  • X-ray Crystallography: Provides high-resolution structural data but requires well-diffracting crystals.

  • Cryo-Electron Microscopy (Cryo-EM): Suitable for studying larger complexes involving BC1L2.

These methods provide insights into how BC1L2's structure facilitates its function in cellulose biosynthesis.

How do mutations in BC1L2 affect plant phenotypes?

Mutations in the BC1 gene result in brittle culms due to defects in secondary cell wall formation . Key phenotypic changes include:

  • Reduced mechanical strength of stems.

  • Altered lignin-to-cellulose ratio, with increased lignin compensating for reduced cellulose.

  • Abnormal sclerenchyma cell morphology.

These phenotypes highlight the importance of BC1L2 in maintaining structural integrity through balanced cell wall composition.

Can BC1L2 be used as a biomarker for cellulose biosynthesis studies?

Yes, BC1L2 serves as a valuable biomarker for studying cellulose biosynthesis pathways. Its expression correlates with active secondary cell wall formation, making it a marker for developmental stages involving high cellulose deposition . Techniques such as quantitative PCR or immunolocalization can track BC1L2 expression patterns under various conditions.

What are the implications of altered BC1L2 activity on bioengineering efforts?

Modulating BC1L2 activity has significant implications for bioengineering crops with improved mechanical strength or altered biomass composition:

  • Enhanced Strength: Overexpressing functional BC1L2 could increase cellulose content, improving stem rigidity.

  • Biofuel Production: Reducing lignin levels while maintaining sufficient cellulose could enhance biomass digestibility for biofuel applications.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.