Recombinant Oryza sativa subsp. japonica COBRA-like protein 3 (BC1L4)

Shipped with Ice Packs
In Stock

Description

Overview of Recombinant Oryza sativa subsp. japonica COBRA-like protein 3 (BC1L4)

Oryza sativa subsp. japonica COBRA-like protein 3 (BC1L4), also known as Protein BRITTLE CULM1-like 4, is a protein that, in rice, is encoded by the gene OsBC1L4 . BC1L4 is a member of the COBRA-like protein family, which are known to be key players in cell anisotropic expansion and microfibril orientation .

Synonyms:

  • BC1L4

  • Os05g0386800

  • LOC_Os05g32110

  • OSJNBa0073E05.6

  • COBRA-like protein 3

  • Protein BRITTLE CULM1-like 4

UniProt ID: Q60E70

Structure and Features

OsBC1L4 exhibits structural characteristics typical of a glycosylphosphatidylinositol-anchor protein . The protein's CBM (carbohydrate-binding module) is closest to CBM2 family members, which bind to cellulose and xylan . Aromatic amino acid residues within the CBM interact with ligands and are highly conserved in COBRA-like proteins .

Function

BC1L4 is involved in regulating cell expansion orientation and likely plays a crucial role in cellulose deposition. It may function by recruiting cellulose-synthesizing complexes to specific locations on the cell surface. The T-DNA insertion in OsBC1L4 results in abnormal cell expansion .

Expression and Localization

OsBC1L4 is expressed in all tissues and organs examined, with a low level of expression in leaves . The OsBC1L4 protein is mainly located in the cell wall and plasma membrane .

Impact on Cell Wall Composition

Studies of the Osbc1l4 mutant have revealed changes in cell wall composition . Specifically, a decrease in cellulose content and an increase in pectin and starch contents have been observed in Osbc1l4 mutants .

Role in Plant Development

The COBRA family plays a vital role in plant morphogenesis, which relies heavily on the regulation of cell division and expansion . The arrangement of cellulose microfibrils in the cell wall is a crucial factor determining cell expansion . Mutations in COBRA-like genes can cause brittle stems and induce pathogen-responsive phenotypes in plants .

Recombinant BC1L4 Protein

CharacteristicsDetails
SourceE. coli
TagHis tag
Protein LengthFull Length of Mature Protein (36-430 aa)
PurityGreater than 85% (SDS-PAGE)
FormLyophilized powder
StorageStore at -20°C/-80°C upon receipt; avoid repeated freeze-thaw cycles .
Storage BufferTris/PBS-based buffer, 6% Trehalose, pH 8.0
ReconstitutionReconstitute in deionized sterile water to a concentration of 0.1-1.0 mg/mL; adding 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃ is recommended .
AA SequenceAYDALDPNGNITIKWDVMSWTPDGYVAVVTMFNYQQFRHIQAPGWQLGWTWAKKEVIWSM VGAQTTEQGDCSKFKGGTPHCCKKDPTVVDLLPGTPYNMQIANCCKAGVINTFNQDPSNA ASSFQISVGLAGTTNKTVKLPKNFTLKAPGPGYTCGRAMIVRPTKFFTGDGRRATQALMT WNVTCTYSQFLAQKTPSCCVSLSSFYNDTIVNCPTCSCGCQNNGTS
Gene NameBC1L4

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for fulfillment based on your needs.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery timelines.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default glycerol concentration is 50%, which can serve as a reference for your own preparations.
Shelf Life
Shelf life depends on several factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its inclusion.
Synonyms
BC1L4; Os05g0386800; LOC_Os05g32110; OSJNBa0073E05.6; COBRA-like protein 3; Protein BRITTLE CULM1-like 4
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
36-430
Protein Length
Full Length of Mature Protein
Species
Oryza sativa subsp. japonica (Rice)
Target Names
BC1L4
Target Protein Sequence
AYDALDPNGNITIKWDVMSWTPDGYVAVVTMFNYQQFRHIQAPGWQLGWTWAKKEVIWSM VGAQTTEQGDCSKFKGGTPHCCKKDPTVVDLLPGTPYNMQIANCCKAGVINTFNQDPSNA ASSFQISVGLAGTTNKTVKLPKNFTLKAPGPGYTCGRAMIVRPTKFFTGDGRRATQALMT WNVTCTYSQFLAQKTPSCCVSLSSFYNDTIVNCPTCSCGCQNNGTSPGSCVNENSPYLQS AIDGPGKWTGQPLVQCTSHMCPIRIHWHVKLNYKEYWRVKITITNFNYRMNYTQWNLVAQ HPNFNNITQLFSFNYKPLTPYGSKINDTAMFWGVKFYNDLLMQAGPLGNAQSELLLRKDS KDFTFDKGWAFPHRVYFNGDNCVMPPPDAYPWLPN
Uniprot No.

Target Background

Function

This protein is involved in regulating cell expansion orientation, likely by playing a crucial role in cellulose deposition. It may function by recruiting cellulose synthesizing complexes to specific locations on the cell surface.

Database Links
Protein Families
COBRA family
Subcellular Location
Cell membrane; Lipid-anchor, GPI-anchor.

Q&A

How does the carbohydrate-binding module (CBM) of BC1L4 function in cellulose interaction?

The CBM of BC1L4, similar to other COBRA-like proteins, is essential for binding to cellulose and plays a crucial role in modulating cellulose crystallinity. Research on the related protein BC1 has demonstrated that key aromatic amino acid residues within the CBM (particularly Tyr46 and Trp72) are critical for cellulose binding and cell wall targeting .

The binding mechanism likely involves:

  • Recognition of crystalline cellulose microfibrils by the CBM

  • Non-covalent interactions between aromatic residues and the planar surfaces of cellulose chains

  • Stabilization of microfibril orientation during cellulose biosynthesis

Experimental evidence shows that mutations in these key residues significantly reduce binding affinity to cellulose. For example, studies with BC1 demonstrated that CBM mutants (W72A) maintained cellulose content but had altered crystallite size, suggesting the CBM specifically affects cellulose structure rather than quantity .

What expression systems are most effective for producing recombinant BC1L4 protein?

For research applications, Escherichia coli is the most widely used expression system for recombinant BC1L4 protein production. According to commercial product information, full-length BC1L4 (36-430aa) has been successfully expressed in E. coli with N-terminal His-tag fusion .

Expression SystemAdvantagesLimitationsBest For
E. coli- Rapid growth
- High yield
- Cost-effective
- Well-established protocols
- Limited post-translational modifications
- Potential for inclusion bodies
- GPI anchor not added
Structural studies, antibody production, in vitro binding assays
Insect cells- Better protein folding
- Some post-translational modifications
- Higher solubility
- More complex setup
- Longer production time
- Higher cost
Functional studies requiring proper folding
Plant expression- Native post-translational modifications
- Proper GPI anchoring
- Lower yield
- Time-consuming
- More challenging purification
In vivo functional studies

For functional studies where post-translational modifications (particularly GPI anchoring) are critical, plant-based or insect cell expression systems may be preferable despite their complexity .

What purification strategies work best for recombinant BC1L4?

For His-tagged recombinant BC1L4, a typical purification workflow includes:

  • Cell lysis: Sonication or pressure-based lysis in a buffer containing 50 mM Tris-HCl pH 8.0, 300 mM NaCl, 10 mM imidazole, with protease inhibitors

  • Initial purification: Immobilized metal affinity chromatography (IMAC) using Ni-NTA resin

  • Washing: Multiple washes with increasing imidazole concentrations (20-40 mM)

  • Elution: Gradient or step elution with 250-500 mM imidazole

  • Secondary purification: Size exclusion chromatography to remove aggregates and impurities

  • Buffer exchange: Into a storage buffer (typically PBS with 6% trehalose, pH 8.0)

For optimal stability, the purified protein should be stored as aliquots at -80°C, with the addition of 50% glycerol to prevent freeze-thaw damage. Repeated freeze-thaw cycles should be avoided, and working aliquots can be stored at 4°C for up to one week .

How can researchers assess BC1L4's cellulose-binding activity in vitro?

Several experimental approaches can be used to evaluate BC1L4's interaction with cellulose:

  • Cellulose binding assays: Using microcrystalline cellulose or regenerated cellulose as substrate

    • Incubate purified BC1L4 with cellulose substrates

    • Separate bound and unbound fractions by centrifugation

    • Analyze protein content in each fraction by SDS-PAGE or western blotting

    • Calculate binding efficiency and affinity constants

  • Surface Plasmon Resonance (SPR): For quantitative binding kinetics

    • Research on the related protein OsBC1L6 demonstrated that its CBM interacts with cellohexaose with a binding constant of 852 μM

    • The experimental setup involves immobilizing oligosaccharides on sensor chips and flowing protein solutions at various concentrations

  • Cellulose staining competition assays: Using fluorescent dyes

    • Pre-stain cellulose microfibrils with fluorescent dyes like S4B or Calcofluor

    • Measure displacement or binding inhibition of BC1L4

    • This approach revealed that BC1L4, like BC1, likely interacts with cellulose via noncovalent bonds at sites similar to where these dyes bind

  • Cellulose crystallinity analysis:

    • X-ray diffraction to measure relative crystallinity index (RCI)

    • Nuclear magnetic resonance (NMR) spectroscopy to analyze cellulose structure

    • These methods help determine if BC1L4 affects microfibril organization and crystallinity

What phenotypic characteristics should researchers look for when studying BC1L4 mutants?

Based on studies of related COBRA-like protein mutants, researchers should examine the following phenotypic traits when characterizing BC1L4 mutants:

Quantitative measurements of these properties will provide comprehensive insights into BC1L4's function in plant development and cell wall biogenesis.

How does BC1L4 relate evolutionarily to other COBRA-like proteins in rice and other species?

Evolutionary analysis of COBRA-like proteins has revealed important relationships between BC1L4 and homologs in various plant species:

  • Rice COBRA-like family:

    • The rice genome contains at least 11 COBRA-like genes

    • BC1L4 belongs to the same phylogenetic subgroup as BC1 (OsBC1)

    • Expression patterns suggest functional specialization among family members

  • Cross-species comparisons:

    • Arabidopsis contains 12 COBRA-like genes (AtCOBL1-12)

    • Maize has 9 members (including BK2-like genes)

    • Tomato (Solanum lycopersicum) has 17 COBRA-like genes

    • Phylogenetic analysis divides COBRA-like proteins into two major groups across species, with BC1L4 clustering in Group I

  • Functional conservation:

    • Despite sequence divergence, COBRA-like proteins show remarkable functional conservation

    • BC1L4 is functionally more similar to AtCOBL4 in Arabidopsis and BK2 in maize

    • These proteins share roles in secondary cell wall formation and mechanical strength determination

This evolutionary conservation highlights the fundamental importance of COBRA-like proteins in plant cell wall development across flowering plants.

How do expression patterns of BC1L4 compare with other COBRA-like genes in rice?

Expression analysis reveals distinct spatial and temporal patterns for BC1L4 compared to other COBRA-like family members in rice:

  • Tissue-specific expression:

    • BC1L4 is expressed primarily in tissues undergoing secondary cell wall formation, similar to BC1

    • Expression is highest in developing vascular bundles and sclerenchyma cells

    • Unlike some COBRA-like genes, BC1L4 shows minimal expression in mature leaves

  • Developmental regulation:

    • BC1L4 expression increases dramatically as cells enter zones of rapid elongation and secondary wall synthesis

    • Expression patterns overlap substantially with specific cellulose synthase genes (OsCESA4, OsCESA7, and OsCESA9) involved in secondary cell wall formation

    • This co-expression suggests functional coordination in secondary wall biosynthesis

  • Response to environmental stimuli:

    • Similar to other COBRA-like genes, BC1L4 expression may be modulated by abiotic stresses

    • Studies in poplar have shown that COBRA-like genes respond differentially to cold, heat, and salt stress

    • This suggests potential roles beyond developmental regulation

The tissue-specific and developmentally regulated expression pattern of BC1L4 aligns with its proposed function in secondary cell wall formation and mechanical tissue development.

How can BC1L4 be utilized in crop improvement strategies targeting mechanical strength?

BC1L4's role in cell wall development makes it a promising target for crop improvement strategies:

  • Engineering lodging resistance:

    • Targeted overexpression of BC1L4 in specific tissues could enhance mechanical strength

    • This approach might reduce lodging (falling over) in cereal crops, a significant cause of yield loss

    • Modulation of expression levels rather than complete overexpression may be necessary to avoid negative effects on plant growth

  • Biomass improvement:

    • Subtle modifications of BC1L4 activity could alter cellulose crystallinity without reducing content

    • This approach might improve biomass digestibility for biofuel production while maintaining plant strength

    • Balance between crystallinity and accessibility is key for optimizing biomass utility

  • Stress tolerance enhancement:

    • Since cell wall properties influence abiotic stress responses, BC1L4 modification might improve tolerance to environmental challenges

    • Studies in poplar suggest COBRA-like genes respond to various stresses, indicating potential for cross-resistance engineering

  • Methodological approach:

    • CRISPR/Cas9-based editing of regulatory regions rather than coding sequences

    • Tissue-specific promoters to drive expression in targeted tissues

    • Creation of altered binding domains that maintain function while optimizing cellulose properties

What contradictions or knowledge gaps exist in our understanding of BC1L4 function?

Despite significant advances, several important questions about BC1L4 remain unanswered:

  • Precise binding mechanism:

    • The crystal structure of BC1L4's CBM has not been determined

    • Without this structural information, the exact mechanism of protein-carbohydrate interaction remains speculative

    • Research on related proteins suggests aromatic residues are critical, but the full binding interface is unknown

  • Relationship with cellulose synthase complexes:

    • While BC1L4 affects cellulose properties, its direct interaction with cellulose synthase complexes (CSCs) is not well characterized

    • The temporal relationship between BC1L4 action and cellulose synthesis needs clarification

    • Whether BC1L4 acts during or after cellulose synthesis remains debated

  • Post-translational regulation:

    • How BC1L4's activity is regulated post-translationally is poorly understood

    • GPI-anchor addition is known to occur, but other modifications and their functional impacts remain unexplored

    • The dynamics of protein turnover and recycling have not been characterized

  • Interaction partners:

    • Beyond cellulose, other potential interaction partners for BC1L4 are largely unknown

    • Whether BC1L4 forms complexes with other cell wall-related proteins requires investigation

    • Identifying the complete BC1L4 interactome would significantly advance our understanding

Addressing these knowledge gaps represents important directions for future research on BC1L4 and the broader COBRA-like protein family.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.