Recombinant Oryza sativa subsp. japonica Copper transporter 2 (COPT2)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for fulfillment based on your needs.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, provided as a guideline for your use.
Shelf Life
Shelf life depends on several factors: storage conditions, buffer composition, temperature, and the protein's inherent stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
COPT2; Os05g0424700; LOC_Os05g35050; OJ1212_B02.11; Copper transporter 2; OsCOPT2
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-151
Protein Length
full length protein
Species
Oryza sativa subsp. japonica (Rice)
Target Names
COPT2
Target Protein Sequence
MDMGGNGMAMPPPPAPVKKARYMHMTFFWGKNTEVLFTLWPGARGGMYALAILFMFALAV LLEFRGYRVLEARLARRRAPRAAAALRTAVHAVRVGVAYLIMLALMSFNGGVFLAIVAGH AAGFLAFRAGLCGGGPAPPLEEDRKNDPVCC
Uniprot No.

Target Background

Function

This recombinant Oryza sativa subsp. japonica Copper transporter 2 (COPT2) protein is involved in copper transport, working in conjunction with SWEET11 and COPT1. It contributes to copper (Cu) removal from the xylem, impacting susceptibility to bacterial pathogens such as Xanthomonas oryzae pv. oryzae (Xoo).

Database Links
Protein Families
Copper transporter (Ctr) (TC 1.A.56) family, SLC31A subfamily
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is Copper Transporter 2 (COPT2) in Oryza sativa subsp. japonica?

Copper Transporter 2 (COPT2) is a member of the COPT family of membrane proteins in rice (Oryza sativa subsp. japonica) that facilitates copper uptake and transport across cellular membranes. As part of the conserved family of copper transporters, COPT2 contains three transmembrane domains and metal-binding motifs that are essential for high-affinity copper transport. The protein plays a crucial role in copper homeostasis, particularly under conditions of copper limitation. COPT2 functions alongside other COPT family members (including COPT1, COPT5, and COPT7) to regulate copper distribution throughout the plant, which is essential for growth, development, and stress responses in rice .

How does COPT2 differ from other copper transporters in the COPT family?

COPT2 differs from other COPT family members primarily in its expression pattern, tissue localization, and specific regulatory mechanisms. While COPT1 and COPT5 appear to have roles in copper uptake with mutations resulting in lower shoot copper concentration, COPT7 mutations lead to increased copper in shoots as observed in experimental studies . COPT2 typically shows higher expression in roots compared to shoots and is strongly induced under copper deficiency conditions. Unlike COPT5, which may function in intracellular compartments, COPT2 is primarily localized to the plasma membrane. Each COPT transporter has evolved specific roles in maintaining copper homeostasis, with COPT2 being particularly important for copper acquisition during deficiency and redistribution during stress responses.

What biological processes in rice involve COPT2?

COPT2 is involved in several critical biological processes in rice:

  • Copper homeostasis - regulating copper uptake and distribution

  • Stress responses - particularly during copper deficiency

  • Viral defense responses - copper transporters are upregulated during viral infections

  • Root development - affecting root architecture through copper-mediated signaling

  • Photosynthetic efficiency - ensuring proper copper delivery to chloroplasts

Research has demonstrated that rice plants respond to viral infections by promoting copper accumulation in shoots through the induction of copper transporter genes, indicating the importance of these transporters in antiviral immunity . During RSV (Rice stripe virus) infection, copper content increased in rice shoots by up to 25%, while the distribution changed with decreased copper in intercellular spaces and increased copper within cells .

What are the standard methods for recombinant expression of rice COPT2?

The recombinant expression of Oryza sativa COPT2 involves several methodological approaches:

  • Vector Selection and Construction: The COPT2 coding sequence is typically cloned into appropriate expression vectors under the control of strong promoters. For plant expression, vectors containing the CaMV 35S promoter or rice-specific promoters are commonly used. For bacterial expression, pET series vectors are preferred.

  • Expression Systems:

    • Plant-based expression: Transgenic rice cells can be either regenerated into whole plants or grown as cell cultures that can be upscaled into bioreactors for protein production .

    • Bacterial expression: E. coli systems (BL21, Rosetta strains) for producing large quantities of protein for biochemical studies.

    • Yeast expression: Particularly useful for functional complementation studies in copper transport mutants.

  • Purification Strategies: Typically involves affinity chromatography using his-tag or other fusion tags, followed by size exclusion chromatography for higher purity.

  • Verification Methods: Western blotting, mass spectrometry, and activity assays to confirm identity and functionality.

For optimal expression in rice systems, researchers often need to optimize codon usage and consider the impact of glycosylation on protein function, as rice possesses complex post-translational glycosylation capabilities that can affect protein quality .

How can I measure COPT2-mediated copper transport activity?

Measuring COPT2-mediated copper transport activity requires specialized techniques that assess copper movement across membranes:

  • Yeast Complementation Assays: Using copper uptake-deficient yeast strains to express COPT2, followed by growth assessment on copper-limited media.

  • Radioisotope Uptake Experiments: Using 64Cu to track copper transport in cells expressing COPT2.

  • ICP-OES Analysis: Inductively coupled plasma optical emission spectrometry can be used to precisely measure copper concentrations in different tissues or cellular compartments . This technique was successfully used to measure copper concentration in rice plants infected with viruses, showing a 25% increase in shoot copper levels upon viral infection .

  • X-ray Fluorescence Spectroscopy (XRF): For detecting relative copper content and spatial distribution in plant tissues .

  • Transmission Electron Microscopy coupled with Energy-Dispersive Spectroscopy (TEM-EDS): For subcellular localization of copper and determination of copper content in specific organelles .

  • Membrane Vesicle Transport Assays: Isolating membrane vesicles from cells expressing COPT2 and measuring copper uptake.

MethodAdvantagesLimitationsApplications
ICP-OESHigh sensitivity, quantitativeDestructive, no spatial infoTotal copper content determination
XRFNon-destructive, spatial mappingLower sensitivityTissue distribution studies
TEM-EDSSubcellular resolutionComplex sample preparationOrganelle-specific localization
RadioisotopeDirect measurement of transportSafety concerns, specialized equipmentTransport kinetics studies

What are the best techniques for studying COPT2 localization in rice cells?

To study COPT2 localization in rice cells, researchers typically employ the following techniques:

  • Fluorescent Protein Fusion: Creating COPT2-GFP (or other fluorescent protein) fusions for live-cell imaging using confocal microscopy.

  • Immunolocalization: Using specific antibodies against COPT2 coupled with fluorescent secondary antibodies for visualization in fixed tissues.

  • Subcellular Fractionation: Isolating different cellular compartments followed by western blotting to detect the presence of COPT2.

  • Electron Microscopy: Immunogold labeling combined with transmission electron microscopy for high-resolution localization studies, similar to the approach used to study copper distribution in rice tissues .

  • Bimolecular Fluorescence Complementation (BiFC): To study protein-protein interactions and co-localization with other transporters or cellular components.

When conducting localization studies, it's crucial to confirm findings using multiple approaches, as each method has potential artifacts. For instance, TEM-EDS analysis showed that virus infection altered copper distribution in rice cells, with copper decreasing in chloroplasts and intercellular spaces while increasing in intracellular compartments .

How is COPT2 expression regulated in response to copper availability?

COPT2 expression is tightly regulated by copper availability through several mechanisms:

  • Transcriptional Regulation: Under copper deficiency, specific transcription factors bind to copper-responsive elements in the COPT2 promoter region to upregulate expression. Similar to what has been observed with other copper-related genes in rice, copper deficiency likely increases COPT2 transcription .

  • Post-transcriptional Regulation: microRNAs may play a role in regulating COPT2 mRNA stability or translation. Research has shown that copper levels affect microRNA expression in rice, particularly miR528, which regulates copper-related processes .

  • Protein Stability and Turnover: Copper availability affects the stability and turnover of COPT proteins through mechanisms involving ubiquitination and endocytosis.

Experimental studies with rice have demonstrated that copper nutritional status significantly affects the expression of copper transporters. Rice seedlings exposed to different copper concentrations (deficient: 0 μM CuSO4, sufficient: 0.5 μM CuSO4, and excess: 10 μM CuSO4) showed distinct molecular phenotypes with different expression patterns of copper-related genes . These findings suggest COPT2 likely follows similar regulation patterns as other members of the COPT family.

What role does COPT2 play in rice development and growth?

COPT2 contributes to rice development and growth through several important functions:

  • Nutrient Acquisition: Facilitates copper uptake from soil, which is essential for plant growth.

  • Photosynthetic Efficiency: Ensures proper copper delivery to plastocyanin, a copper-containing protein critical for photosynthetic electron transport.

  • Root Architecture: Influences root development and architecture through copper-mediated signaling pathways.

  • Oxidative Stress Response: Helps maintain appropriate copper levels for copper/zinc superoxide dismutase (Cu/Zn-SOD) activity, protecting against oxidative damage.

  • Reproduction and Seed Development: Contributes to proper copper distribution during reproductive development.

The importance of copper transporters in rice growth is highlighted by their involvement in viral resistance. Rice plants with mutations in certain copper transporters (such as HMA5, COPT1, and COPT5) showed altered susceptibility to viral infections and changes in growth patterns . This suggests COPT2 likely has similar developmental significance, particularly under stress conditions.

What protein-protein interactions are known for COPT2?

Several protein-protein interactions have been identified for COPT2:

  • Self-interaction: COPT2 can form homomeric complexes that create a pore for copper transport.

  • Other COPT family members: COPT2 may interact with other COPT proteins to form heteromeric complexes with distinct properties.

  • Chaperones: Interactions with copper chaperones that receive copper from transporters and deliver it to target proteins.

  • Regulatory proteins: Interactions with kinases, phosphatases, and ubiquitin ligases that regulate COPT2 activity and turnover.

While the specific interactome of rice COPT2 has not been fully characterized, insights from other COPT family members suggest these interactions are critical for function. Research methodologies for studying these interactions include yeast two-hybrid screens, co-immunoprecipitation, and bimolecular fluorescence complementation assays.

How does COPT2 contribute to viral resistance in rice?

COPT2, as a member of the COPT family of copper transporters, likely plays a significant role in viral resistance in rice through copper-mediated defense mechanisms:

  • Copper Redistribution: During viral infection, rice plants redistribute copper within tissues and cells. Research has shown that rice promotes copper accumulation in shoots by inducing copper transporter genes to counteract viral infection . COPT2 likely participates in this process, facilitating copper movement to sites where it contributes to antiviral activities.

  • Antiviral Signaling: Copper serves as a signaling molecule that activates defense responses. Studies have demonstrated that mutations in copper transporters like COPT1 and COPT5 affect copper concentration in shoots and susceptibility to viral infections .

  • ROS Management: Copper is essential for ROS (reactive oxygen species) metabolism, which plays a dual role in virus infection - both in defense signaling and in limiting virus damage.

  • RNA Silencing Enhancement: Copper may enhance RNA silencing pathways that target viral genomes.

Experimental evidence shows that rice seedlings growing under copper-excess conditions experience less severe stunting after viral infection compared to copper-sufficient seedlings, while copper-deficient seedlings exhibit more severe stunting . This demonstrates the importance of copper status in viral resistance, with COPT2 likely being a key player in this process.

What is the relationship between COPT2 and drought or climate stress adaptation?

COPT2 likely contributes to drought and climate stress adaptation in rice through several mechanisms:

  • Water Use Efficiency: Proper copper distribution impacts stomatal regulation and water use efficiency, which is crucial during drought.

  • Oxidative Stress Management: Under drought conditions, plants experience oxidative stress. COPT2-mediated copper delivery to Cu/Zn-SOD enhances antioxidant capacity.

  • Photosynthetic Resilience: By ensuring copper availability to photosystems, COPT2 helps maintain photosynthetic efficiency during stress.

  • Stress Signaling Integration: Copper acts as a secondary messenger in stress signaling networks that respond to drought and temperature fluctuations.

Scientists are working to develop hyperefficient, drought-resistant rice strains to address climate change challenges . As the world faces increasing temperatures and more erratic weather patterns, including more frequent and intense droughts, understanding copper transport systems becomes crucial for developing climate-resilient rice varieties . The manipulation of copper transporters like COPT2 could potentially contribute to these breeding efforts.

How does COPT2 function change under various abiotic stresses?

COPT2 function undergoes significant changes under various abiotic stresses:

  • Heat Stress: Elevated temperatures may alter COPT2 activity through changes in membrane fluidity and protein conformation.

  • Salinity Stress: Salt stress affects ion homeostasis, potentially altering COPT2 expression and function to maintain proper copper balance.

  • Nutrient Deficiency: Deficiencies in other nutrients can impact COPT2 expression as part of cross-talk between different nutrient sensing pathways.

  • Heavy Metal Stress: Exposure to excess heavy metals may competitively inhibit COPT2-mediated copper transport.

  • Oxidative Stress: ROS accumulation during stress may modify COPT2 protein through oxidation of critical cysteine residues.

Each stress condition requires specific methodological approaches to study COPT2 function, including controlled growth environments, stress application protocols, and multi-omics analyses to capture changes in expression, protein modification, and interaction networks. Studies have shown that copper distribution in rice changes significantly under stress conditions like viral infection , suggesting COPT2 regulation and function are likely responsive to various environmental challenges.

How can COPT2 be engineered for improved rice stress tolerance?

Engineering COPT2 for improved rice stress tolerance involves several sophisticated approaches:

  • Promoter Modification: Replacing the native COPT2 promoter with stress-inducible or tissue-specific promoters to optimize expression patterns. This would allow for enhanced copper transport specifically under stress conditions or in tissues where it's most beneficial.

  • Protein Engineering: Modifying COPT2 protein structure to alter:

    • Transport kinetics (Km and Vmax values)

    • Metal selectivity

    • Regulation by post-translational modifications

    • Protein stability and turnover rates

  • Co-expression Strategies: Coordinated expression with copper chaperones or other transporters to optimize copper distribution networks.

  • CRISPR/Cas9 Gene Editing: Creating precise modifications in the COPT2 coding sequence or regulatory regions to enhance function.

  • Expression Level Optimization: Finding the optimal expression level that enhances stress tolerance without causing copper toxicity.

Research has shown that copper status significantly affects rice resistance to stresses such as viral infections . Rice seedlings growing under copper-excess conditions (10 μM CuSO4) showed enhanced resistance to RSV infection compared to plants grown under copper-sufficient (0.5 μM CuSO4) or copper-deficient (0 μM CuSO4) conditions . This suggests that engineering COPT2 to enhance copper uptake and distribution could be a viable strategy for improving stress tolerance.

What are the best experimental designs for studying COPT2 function in field conditions?

Studying COPT2 function in field conditions requires carefully designed experiments:

  • Multi-location Trials: Testing COPT2-modified rice in different geographical locations to capture environmental variation.

  • Split-plot Designs: Incorporating different copper application treatments within genotype plots to assess COPT2 function under varying copper availability.

  • Time-course Sampling: Collecting samples throughout the growing season to capture temporal dynamics of COPT2 expression and copper distribution.

  • Multi-stress Experiments: Imposing controlled stress treatments (drought, pathogen inoculation) in field settings to assess COPT2 contribution to stress resilience.

  • High-throughput Phenotyping: Employing field-based phenomics to correlate COPT2 function with physiological traits.

Experimental ComponentMethodologyMeasurementsSignificance
Genotype variationCOPT2 wild-type vs. modified linesGrowth, yield, stress resilienceFunctional impact assessment
Copper applicationSoil and foliar treatmentsTissue copper content, distributionCopper uptake efficiency
Stress treatmentsDrought, pathogen exposureStress damage, recovery rateStress response contribution
Temporal analysisRegular sampling throughout seasonExpression patterns, protein levelsDevelopmental regulation

Careful experimental design must consider soil heterogeneity, weather variations, and potential confounding factors while maintaining statistical power through appropriate replication and randomization.

How does COPT2 function integrate with other copper transporters in the COPT family?

COPT2 functions as part of a sophisticated network of copper transporters that collectively maintain copper homeostasis:

  • Spatial Coordination: Different COPT transporters operate in distinct cellular locations and tissues. While some research suggests COPT1 and COPT5 are involved in copper uptake (mutations leading to lower shoot copper), COPT7 appears to play a role in copper efflux or compartmentalization (mutations leading to increased shoot copper) .

  • Temporal Regulation: COPT transporters show differential expression patterns during development and in response to environmental cues.

  • Functional Redundancy and Specialization: Some functions overlap between COPT family members, providing redundancy, while others are specialized. Research on copper transporters in rice has shown that individual mutations in COPT genes have distinct phenotypic effects, suggesting both redundant and specialized functions .

  • Regulatory Networks: Common regulatory elements control multiple COPT genes, allowing for coordinated responses.

  • Protein-Protein Interactions: COPT proteins can interact with each other and with other copper transport machinery components.

Studies have demonstrated that mutations in individual COPT genes affect copper distribution and stress responses differently. For example, copt1 and copt5 mutant lines had less copper in shoots, while copt7 mutant lines had more copper in shoots . These findings illustrate the complex integration of COPT2 function within the broader copper transport network.

What role could COPT2 play in biofortification of rice with essential micronutrients?

COPT2 could play a significant role in biofortification strategies for enhancing the micronutrient content of rice:

Biofortification approaches could include conventional breeding for optimal COPT2 alleles, transgenic approaches with modified COPT2 expression, or gene editing to optimize COPT2 function. These strategies align with broader efforts to develop rice varieties that can better withstand environmental challenges while providing improved nutritional content .

What are the future research directions for COPT2 in rice?

Future research on COPT2 in rice will likely focus on several promising directions:

  • Systems Biology Approaches: Integrating COPT2 function into comprehensive models of copper homeostasis and stress responses through multi-omics analyses.

  • Structure-Function Studies: Resolving the three-dimensional structure of COPT2 to understand transport mechanisms and design improved variants.

  • Climate Resilience Applications: Leveraging COPT2 engineering to enhance rice adaptation to climate change, building on research into hyperefficient, drought-resistant rice varieties .

  • Pathogen Resistance: Further exploring the role of COPT2 in viral and other pathogen resistance mechanisms, expanding on findings that copper transporters contribute to antiviral defense .

  • Biotechnological Applications: Developing COPT2-based tools for broader applications in plant biotechnology and potentially for recombinant protein production systems in rice .

  • Field Implementation: Moving from laboratory studies to field trials of COPT2-modified rice lines to assess real-world performance and environmental interactions.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.