Recombinant Oryza sativa subsp. japonica Copper transporter 3 (COPT3)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, provided as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type will be determined during the production process. If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
COPT3; Os01g0770800; LOC_Os01g56430; P0665A11.23; Copper transporter 3; OsCOPT3
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-150
Protein Length
full length protein
Species
Oryza sativa subsp. japonica (Rice)
Target Names
COPT3
Target Protein Sequence
MADMGRHGMAMAMAPAAAGGAGRRKRYMHMTFYWGKNSEILFTGWPGASGGMYALALAAV FALAVLLEFLGSPRVQESSSLGSRRRRATAAAVHAVRVGLAYLLMLALMSFNVGVLLAAV AGHAAGFLAFRAGLCGGGYKKGELAPAACC
Uniprot No.

Target Background

Function
Involved in copper transport.
Database Links
Protein Families
Copper transporter (Ctr) (TC 1.A.56) family, SLC31A subfamily
Subcellular Location
Membrane; Multi-pass membrane protein.

Q&A

What is COPT3 and what is its fundamental role in rice copper transport?

COPT3 is a member of the copper transporter (COPT/Ctr) gene family in Oryza sativa subsp. japonica. It possesses the conserved structural features characteristic of COPT/Ctr-type copper transporters, enabling it to participate in copper uptake and translocation within rice tissues. Unlike some transporters that can function independently, COPT3 operates in cooperation with COPT6 to mediate high-affinity copper uptake, as demonstrated through complementation studies in yeast mutants lacking endogenous copper transporters. This cooperative behavior suggests COPT3 functions within a complex network of proteins regulating copper homeostasis in rice. The protein exhibits tissue-specific expression patterns, indicating specialized roles in different plant organs and developmental stages .

What experimental systems have been used to confirm COPT3 function?

The primary experimental system used to confirm COPT3 function is the yeast complementation assay utilizing Saccharomyces cerevisiae mutants deficient in endogenous copper transporters (ScCtr1 and ScCtr3). This approach has demonstrated that COPT3, when co-expressed with COPT6, can rescue the growth defects of these yeast mutants under copper-limited conditions, confirming its role as a high-affinity copper transporter. Importantly, expression of COPT3 alone was insufficient to complement the yeast mutant phenotype, highlighting its dependence on interaction with COPT6. The specificity of COPT3 for copper transport was confirmed by its inability to complement yeast mutants lacking transporters for other metals like iron or zinc, even when co-expressed with other rice COPT proteins .

How is COPT3 expression regulated in response to metal availability?

COPT3 expression exhibits sophisticated regulation in response to metal availability, particularly copper. Its expression pattern changes in response to varying copper concentrations, likely as part of the plant's adaptive response to maintain optimal copper homeostasis. Interestingly, COPT3 expression is also transcriptionally influenced by the availability of other metals, including iron, manganese, and zinc, suggesting cross-talk between different metal homeostasis pathways. This multi-metal regulation indicates that COPT3 functions within an integrated metal regulatory network rather than in isolation. The specific regulatory mechanisms may involve metal-responsive transcription factors and cis-regulatory elements in the COPT3 promoter region, though these elements have been better characterized in other plant species than specifically for rice COPT3 .

What methodologies are recommended for analyzing COPT3 protein-protein interactions?

The split-ubiquitin system has proven effective for investigating protein-protein interactions involving membrane proteins like COPT3. This methodology offers significant advantages over traditional yeast two-hybrid systems for membrane-bound transporters. Implementation requires:

  • Cloning the full-length COPT3 cDNA into appropriate vectors (pBT3-SUC and pPR3-SUC) using gene-specific primers

  • Fusing the 3' ends of COPT cDNAs with the 5' end of the sequence encoding NubG

  • Co-transforming constructs into host yeast strain NMY51

  • Assessing interactions through growth on selective media (lacking His or Ade) and measuring β-galactosidase activity

This approach has successfully demonstrated that COPT3 physically interacts with COPT6 but not with other rice COPTs (except for the known COPT1-COPT5 interaction). When designing such experiments, ensuring proper membrane protein orientation is critical, as is the inclusion of appropriate positive and negative controls to validate interaction specificity .

How should experiments be designed to distinguish between direct and indirect effects of COPT3 on copper homeostasis?

Designing experiments to distinguish between direct and indirect effects of COPT3 requires a multi-layered approach:

Experimental Design Framework:

ApproachMethodologyControlsData Analysis
Genetic manipulationCRISPR/Cas9 knockout or RNAi knockdown of COPT3Wild-type plants, complementation with COPT3Phenotypic analysis, metal content analysis
Protein interactionSplit-ubiquitin system, co-immunoprecipitationProtein interaction mutantsQuantitative binding analysis
Metal transportRadioactive 64Cu uptake assays in heterologous systemsSystems expressing non-functional COPT3 mutantsKinetic analysis (Km, Vmax)
Subcellular localizationFluorescent protein fusion, immunolocalizationLocalization of other COPT family membersCo-localization analysis
Transcriptomic analysisRNA-seq comparing wild-type vs. COPT3 mutantsMultiple metal conditionsPathway enrichment analysis

Factorial experimental designs should be employed to assess COPT3 function under combinations of different metal availabilities (Cu, Fe, Zn, Mn), as the search results indicate that deficiencies in these metals influence COPT3 expression. This approach helps identify potential interaction effects between different metal homeostasis pathways and isolates the specific contribution of COPT3 to copper transport under various physiological conditions .

What are the key considerations when expressing recombinant COPT3 for functional studies?

When expressing recombinant COPT3 for functional studies, several critical parameters must be optimized:

  • Expression System Selection: Heterologous systems like yeast provide a clean background for functional characterization but may lack plant-specific post-translational modifications. Plant-based expression systems preserve native modifications but have higher background copper transport activity.

  • Protein Tagging Strategy: N-terminal vs. C-terminal tags can differentially affect COPT3 function. Copper transporters typically have metal-binding motifs in their N-terminal domains, making C-terminal tags generally preferable, though empirical verification is essential.

  • Partner Protein Co-expression: As COPT3 functions in cooperation with COPT6, co-expression of both proteins is often necessary for proper functional assessment. Sequential transformation or dual-expression vectors should be considered.

  • Metal Supplementation Protocol: Precise control of copper concentrations in growth media is crucial. Pre-culture conditions should standardize the metal status of cells before experimental treatments to minimize variation.

  • Functionality Verification: Multiple approaches should validate the recombinant protein's functionality, including complementation assays, subcellular localization studies, and direct metal uptake measurements .

How can contradictory data about COPT3 function be reconciled in meta-analyses?

Reconciling contradictory data about COPT3 function requires systematic approaches to address data heterogeneity:

What experimental design principles should be applied when studying COPT3 expression under multiple metal stress conditions?

When studying COPT3 expression under multiple metal stress conditions, implement a factorial experimental design rather than a simple one-factor-at-a-time approach. This is critical because:

  • Interaction Detection: Rice COPT3 expression is influenced by multiple metals (Cu, Fe, Mn, Zn), and factorial designs can detect interactions between these factors that would be missed in simpler designs.

  • Statistical Efficiency: Factorial designs yield more information per experiment, providing narrower confidence intervals with the same number of experiments compared to one-factor-at-a-time approaches.

  • Replication Strategy: Include sufficient replication (minimum 3× recommended) to distinguish factor effects from experimental error. This is particularly important given that metal homeostasis responses can show significant biological variation.

  • Control Parameter Selection:

    • Primary factors: Metal concentrations (Cu, Fe, Mn, Zn)

    • Secondary factors: Temperature, light conditions, growth stage

    • Ensure consistent experimental units (same rice cultivar, growth conditions) to minimize uncontrolled variation

  • Response Variable Selection: Measure multiple responses including:

    • COPT3 transcript levels (qRT-PCR)

    • Protein abundance (Western blot)

    • Metal content in tissues (ICP-MS)

    • Physiological responses (growth, photosynthetic efficiency)

This comprehensive approach allows researchers to develop models that accurately describe how COPT3 responds to complex metal environments, better reflecting natural conditions plants encounter .

What are the recommended protocols for analyzing COPT3-mediated copper transport in planta?

Analyzing COPT3-mediated copper transport in planta requires a multi-faceted approach:

Recommended Protocol Suite:

  • Genetic Materials Preparation:

    • Generate COPT3 overexpression lines, knockdown/knockout mutants, and COPT3-reporter fusions

    • Include appropriate controls: wild-type plants, plants with altered expression of other COPT family members

  • Metal Distribution Analysis:

    • Apply 64Cu radiolabeling to track copper movement in different tissues

    • Employ synchrotron X-ray fluorescence microscopy for high-resolution imaging of copper localization

    • Use inductively coupled plasma mass spectrometry (ICP-MS) for quantitative measurement of copper content

  • Subcellular Localization:

    • Perform immunolocalization or fluorescent protein fusion analyses

    • Conduct subcellular fractionation followed by western blotting

    • Use electron microscopy with immunogold labeling for high-resolution localization

  • Functional Transport Assay:

    • Monitor copper uptake kinetics in isolated protoplasts

    • Implement FRET-based copper sensors to track real-time copper movement

    • Analyze copper-dependent physiological responses in different genetic backgrounds

  • Interaction Analysis:

    • Perform co-immunoprecipitation to confirm in planta interaction with COPT6

    • Apply bimolecular fluorescence complementation to visualize protein interactions in situ

    • Conduct yeast three-hybrid assays to identify regulatory proteins

This integrated approach provides complementary datasets that collectively offer a comprehensive picture of COPT3-mediated copper transport dynamics within the plant system .

How can researchers effectively study the evolutionary conservation of COPT3 function across rice varieties?

Studying evolutionary conservation of COPT3 across rice varieties requires a systematic comparative approach:

  • Sequence Analysis Framework:

    • Conduct whole-genome sequencing or targeted sequencing of COPT3 from diverse rice germplasm

    • Perform multiple sequence alignment to identify conserved domains, particularly the transmembrane regions and metal-binding motifs

    • Calculate selection pressures (Ka/Ks ratios) to determine evolutionary constraints on different protein regions

  • Structural Conservation Assessment:

    • Generate homology models based on known COPT/Ctr structures

    • Identify structurally conserved regions that may indicate functional importance

    • Predict the impact of natural variation on protein-protein interactions, particularly with COPT6

  • Functional Conservation Testing:

    • Express COPT3 variants from different rice subspecies in yeast complementation systems

    • Quantify copper transport efficiency across variants

    • Assess whether interaction with COPT6 is maintained across different rice COPT3 orthologs

  • Expression Pattern Comparison:

    • Analyze promoter regions for conserved cis-regulatory elements

    • Compare expression patterns under various metal stress conditions

    • Identify conservation or divergence in metal-responsive expression

  • Comparative Phenotyping:

    • Evaluate copper efficiency traits in diverse rice varieties

    • Correlate phenotypic differences with COPT3 sequence or expression variations

    • Perform association mapping to link natural COPT3 variants with adaptive traits

This comprehensive approach allows researchers to understand how COPT3 function has been maintained or diversified across rice evolution, providing insights into its fundamental importance for copper homeostasis in this critical crop species .

What are the major technical challenges in studying COPT3 function in rice?

Several significant technical challenges complicate COPT3 research:

  • Functional Redundancy: The presence of seven COPT family members in rice creates redundancy that can mask phenotypes in single-gene knockout studies. The specific cooperation between COPT3 and COPT6 further complicates functional isolation of COPT3-specific effects.

  • Protein Complex Stability: COPT3 functions in cooperation with COPT6, making it challenging to isolate and study the native protein while maintaining physiologically relevant interactions. Membrane protein complexes are notoriously difficult to extract and purify while preserving native conformations.

  • Metal Concentration Control: Precisely controlling copper concentrations in plant growth media is challenging due to contamination issues, metal leaching from containers, and varying background levels in water and nutrients. This makes standardization across laboratories difficult.

  • Tissue-Specific Expression: COPT3 shows tissue-specific expression patterns, requiring sophisticated approaches to study its function in specific cell types or developmental stages without the confounding effects of expression in other tissues.

  • Cross-Talk Between Metals: The observed influence of iron, manganese, and zinc deficiency on COPT3 expression indicates complex regulatory networks that are difficult to disentangle experimentally. Single-metal studies may not capture the true physiological context of COPT3 function .

Addressing these challenges requires integrated approaches combining genetics, biochemistry, and advanced imaging techniques, as well as careful experimental design that accounts for the complex regulatory networks governing metal homeostasis in plants.

How might COPT3 research contribute to improving rice varieties for agriculture?

COPT3 research has significant potential to contribute to agricultural improvement of rice varieties through several pathways:

Potential Agricultural Applications of COPT3 Research:

Application AreaResearch ApproachExpected Benefits
BiofortificationModulating COPT3 expression to enhance grain copper contentImproved nutritional quality of rice, addressing micronutrient deficiencies
Stress ToleranceEngineering COPT3 variants with optimized metal transport capabilityEnhanced tolerance to metal deficiency or excess conditions in marginal soils
Pathogen ResistanceExploring COPT3 role in copper-dependent defense responsesDevelopment of varieties with improved resistance to pathogens like Xanthomonas oryzae
Yield StabilityOptimizing copper homeostasis for consistent performance across environmentsReduced yield losses under variable soil conditions
Reduced Fertilizer RequirementsFine-tuning copper acquisition efficiencyLower input costs and environmental impact of copper fertilizers

Future work should focus on translational research that bridges fundamental understanding of COPT3 function with applied breeding programs. This includes developing molecular markers based on optimal COPT3 alleles, creating transgenic lines with engineered COPT3 expression patterns, and field testing of varieties with modified copper transport networks under diverse agricultural conditions .

What emerging technologies could advance our understanding of COPT3 function?

Several emerging technologies hold promise for advancing COPT3 research:

  • CRISPR-Based Technologies:

    • Base editing and prime editing for precise modification of COPT3 regulatory regions

    • CRISPR activation/interference systems for spatiotemporal control of COPT3 expression

    • CRISPR screens to identify genetic interactors of COPT3

  • Advanced Imaging Techniques:

    • Live-cell imaging with metal-specific fluorescent probes

    • Super-resolution microscopy for visualizing COPT3 distribution in membranes

    • Cryo-electron microscopy for structural determination of COPT3-COPT6 complexes

  • Single-Cell Approaches:

    • Single-cell transcriptomics to resolve cell-type-specific COPT3 expression patterns

    • Single-cell proteomics to quantify COPT3 abundance at unprecedented resolution

    • Spatial transcriptomics to map COPT3 expression across tissue architecture

  • Synthetic Biology Tools:

    • Engineered copper-responsive circuits to probe COPT3 regulation

    • Minimal synthetic copper transport systems to define essential COPT3 functions

    • Orthogonal translation systems for incorporating non-canonical amino acids into COPT3

  • Computational Approaches:

    • Machine learning algorithms to predict COPT3 function from sequence variation

    • Molecular dynamics simulations of copper transport through COPT3-COPT6 complexes

    • Systems biology models integrating copper homeostasis networks

These technologies, particularly when applied in combination, offer unprecedented opportunities to resolve the molecular mechanisms of COPT3 function and its integration into the broader copper homeostasis network in rice .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.