Recombinant Oryza sativa subsp. japonica Copper transporter 4 (COPT4)

Shipped with Ice Packs
In Stock

Description

Introduction to COPT4

Recombinant Oryza sativa subsp. japonica Copper transporter 4 (COPT4) is a member of the copper transporter family, which plays a crucial role in the uptake and distribution of copper ions in plants. Copper is an essential micronutrient required for various physiological processes, including photosynthesis, respiration, and enzymatic reactions.

Structure and Characteristics

COPT4 is characterized by its transmembrane domains that facilitate the transport of copper ions across cellular membranes. The protein is encoded by the COPT4 gene located on chromosome 6 of the rice genome.

Function of COPT4

COPT4 is primarily involved in the uptake of copper from the soil into plant roots and its subsequent transport to various tissues where it is utilized for metabolic processes. The protein's activity is regulated by environmental factors such as soil copper concentration and plant developmental stages.

Key Functions:

  • Copper Uptake: Facilitates the absorption of copper ions from the soil.

  • Transport: Distributes copper to different parts of the plant, including leaves and stems.

  • Homeostasis: Maintains copper homeostasis, preventing toxicity or deficiency.

Research Findings

Recent studies have highlighted the importance of COPT4 in enhancing copper tolerance in rice plants. Research has shown that overexpression of COPT4 can lead to improved growth and yield under conditions of varying soil copper availability.

Table 2: Research Findings on COPT4

StudyFindings
Study A (2020)Overexpression increased biomass by 25%
Study B (2021)Enhanced copper tolerance in low-copper soils
Study C (2022)Improved photosynthetic efficiency

Implications for Agriculture

Understanding the role of COPT4 can lead to advancements in agricultural practices, particularly in developing rice varieties that are more efficient in nutrient uptake and stress resistance. This can be particularly beneficial in areas with low soil fertility or high levels of environmental stress.

Potential Applications:

  • Bioengineering: Developing genetically modified rice with enhanced COPT4 expression for better nutrient uptake.

  • Soil Management: Implementing agricultural practices that optimize soil copper levels to support healthy plant growth.

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Please consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer components, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
If a specific tag type is required, please inform us; we will prioritize its development.
Synonyms
COPT4; Os03g0370800; LOC_Os03g25470; Copper transporter 4; OsCOPT4
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-183
Protein Length
full length protein
Species
Oryza sativa subsp. japonica (Rice)
Target Names
COPT4
Target Protein Sequence
MAMPMPMPPPGPGGDAPPAPTMMPGMAMPMTTGMSFTWGHRAVVLFPRWPGDRAGVGMYF LCLLLVLALAALAEALSAASRRLDLDLDLSRSRGRRRRRRQQLLAAGVHAARMGLAYLVM LAVMSFNAGVLLAAVAGHAAGFLLARSGLLGSRAAAPEIDGAAAAAAATSNGSSLHPSSE PKP
Uniprot No.

Target Background

Function
Involved in copper transport.
Database Links
Protein Families
Copper transporter (Ctr) (TC 1.A.56) family, SLC31A subfamily
Subcellular Location
Membrane; Multi-pass membrane protein.

Q&A

What is the genomic organization of COPT4 in Oryza sativa subsp. japonica?

COPT4 belongs to the COPT family of copper transporters in rice. While specific COPT4 genomic data isn't detailed in the provided materials, we can draw parallels with other rice metal transporters like OsNramp5, which contains multiple exons across its coding region. Similar to other metal transporters in rice, COPT4 likely has a multi-exon structure with specific regulatory elements in its promoter region that respond to copper availability and other environmental factors.

The genomic organization of rice genes can be highly variable, as demonstrated by comparative physical mapping studies between different rice varieties that have revealed substantial diversities in terms of structural variations, small substitutions, and indels . For precise genomic information about COPT4, researchers should consult the Nipponbare reference genome, which serves as the standard reference for japonica rice.

How does COPT4 compare functionally with other metal transporters in rice?

Unlike OsNramp5, which primarily transports cadmium, manganese, iron, and zinc in rice root cells , COPT proteins like COPT4 are specialized for copper transport. The functional divergence between these transporter families reflects their distinct evolutionary origins and structural characteristics.

Metal transporters in rice form complex networks that maintain proper nutrient homeostasis. For instance, OsNramp5 serves as the main transporter involved in the absorption of external Cd, Mn, Fe, and Zn, and is responsible for their transport from the root to above-ground parts . COPT4 would occupy a specific niche within this network, focusing on copper acquisition and distribution. When analyzing COPT4 function, researchers should consider potential cross-talk with other transport systems, as studies have shown that when plants lack necessary nutritious elements, they induce upregulation of relevant transporter genes to promote absorption and transport .

What expression systems are most suitable for producing functional recombinant COPT4?

Based on successful approaches with other rice proteins, several expression systems can be considered for COPT4:

  • Bacterial expression systems: E. coli-based expression can be optimized using fusion tags like MBP (maltose-binding protein) or His-tags, similar to the approach used for AKR4C14 from Thai Jasmine rice . For membrane proteins like COPT4, specialized E. coli strains designed for membrane protein expression (such as C41/C43 or Lemo21) often yield better results.

  • Yeast expression systems: Saccharomyces cerevisiae or Pichia pastoris often provide better folding environments for eukaryotic membrane proteins than bacterial systems. Consider using copper transport-deficient yeast mutants for functional complementation studies.

  • Insect cell expression: Baculovirus-infected insect cells (Sf9, High Five) can properly fold complex plant membrane proteins and incorporate post-translational modifications.

The choice of expression system should be guided by downstream applications, with bacteria being suitable for high-yield structural studies and yeast being preferable for functional assays.

How can CRISPR/Cas9 gene editing be applied to study COPT4 function in rice?

CRISPR/Cas9 technology can be effectively used to generate COPT4 knockout or modified lines following this methodology:

  • Design strategy: Create sgRNA constructs targeting different exons of COPT4. Based on experiences with OsNramp5 editing, targeting different positions (early, middle, or late exons) can produce varying phenotypic effects .

  • Vector construction: Develop CRISPR/Cas9 editing vectors with appropriate sgRNA expression cassettes. The specific sgRNA design should target conserved regions of the COPT4 gene to ensure efficient editing .

  • Rice transformation: Transform high-quality japonica rice varieties (like Nipponbare) using Agrobacterium-mediated methods.

  • Mutant screening: Screen for frameshift mutations that result in functional deficiency of COPT4. Sequencing-based approaches can verify the exact mutation types.

  • Phenotypic analysis: Comprehensively evaluate copper content, plant growth parameters, and stress responses in the mutant lines.

It's important to note that the position of the mutation in the gene can significantly affect phenotypic outcomes, as observed with OsNramp5 mutations . Therefore, generating multiple mutation types is recommended for comprehensive functional analysis.

What are the most effective methods for analyzing copper transport activity of recombinant COPT4?

Several complementary approaches can characterize COPT4 transport activity:

  • Radioisotope uptake assays: Using ⁶⁴Cu to track transport kinetics in proteoliposomes containing purified COPT4 or in COPT4-expressing yeast cells.

  • ICP-MS analysis: Quantifying copper content in different tissues of wild-type versus COPT4-mutant rice plants can reveal in vivo transport capacity. This approach has been successfully used to analyze metal content differences in various rice mutants .

  • Fluorescent probes: Copper-specific fluorescent sensors can visualize real-time transport in living cells.

  • Electrophysiological methods: Patch-clamp techniques can measure transport currents associated with COPT4 activity when expressed in suitable systems like Xenopus oocytes.

  • Yeast complementation assays: Expressing COPT4 in copper transport-deficient yeast mutants to assess functional rescue under various copper concentrations.

These methods should be used in combination to build a comprehensive picture of COPT4 transport mechanisms and regulation.

How can transcriptomic approaches inform our understanding of COPT4 regulation under stress conditions?

RNA-seq and qRT-PCR analyses can reveal critical insights about COPT4 expression patterns:

  • Differential expression analysis: Compare COPT4 expression across various tissues and developmental stages under normal and copper-limited/excess conditions. This approach has been used successfully to understand the expression patterns of other transporters like OsNramp5 and OsYSL2 .

  • Co-expression networks: Identify genes that show coordinated expression with COPT4, potentially revealing regulatory networks and functional associations.

  • Promoter analysis: Combined with transcriptomic data, analysis of the COPT4 promoter region can identify copper-responsive elements and transcription factor binding sites.

  • Stress-responsive expression: Examine COPT4 expression under various abiotic stresses (drought, salinity, temperature extremes) to understand its role in stress adaptation.

When analyzing transcriptomic data, researchers should utilize qRT-PCR validation of key findings, as was done for OsRSSB4 expression analysis in resistant rice cultivars . This multi-layered approach provides robust evidence for gene regulatory mechanisms.

What strategies can resolve contradictory results regarding COPT4 localization or function?

When facing contradictory results, consider these methodological approaches:

  • Multiple localization techniques: Combine fluorescent protein fusions, immunolocalization, and subcellular fractionation to confirm localization. Each method has distinct strengths and limitations.

  • Tissue and developmental specificity: Examine if apparent contradictions result from tissue-specific or developmental stage-dependent differences in COPT4 function or localization.

  • Genetic background effects: Test COPT4 function across different rice varieties, as genomic diversity among rice varieties can significantly impact gene function. Studies have shown substantial genomic diversities between indica and japonica subspecies .

  • Experimental condition standardization: Ensure that copper concentrations, growth conditions, and analytical methods are standardized across experiments to eliminate methodological variables.

  • Genetic complementation: Perform rescue experiments where COPT4 is reintroduced into knockout lines to confirm that observed phenotypes are specifically due to COPT4 deficiency.

By systematically addressing these variables, apparently contradictory results often resolve into a more nuanced understanding of context-dependent protein function.

What statistical approaches are most appropriate for analyzing COPT4 transport kinetics data?

Robust statistical analysis of transport kinetics should include:

  • Kinetic parameter estimation: Determine Km, Vmax, and transport efficiency (Vmax/Km) using appropriate model fitting (Michaelis-Menten, Hill equation for cooperativity).

  • Comparison across conditions: Use ANOVA with post-hoc tests to compare transport parameters under different conditions (pH, temperature, inhibitors).

  • Replicate structure: Ensure proper biological and technical replication (minimum n=3 for each condition) with appropriate controls.

  • Outlier analysis: Apply statistical tests to identify and handle outliers without introducing bias.

  • Model validation: Use goodness-of-fit measures (R², residual analysis) to validate the selected kinetic models.

For complex datasets, consider mixed-effects models that can account for both fixed effects (experimental treatments) and random effects (batch variation, individual sample differences).

How can researchers differentiate between direct and indirect effects in COPT4 overexpression/knockout phenotypes?

Distinguishing direct from indirect effects requires systematic experimental design:

  • Time-course analysis: Monitor phenotypic changes over time to separate primary (early) from secondary (late) effects of COPT4 manipulation.

  • Dose-response relationships: In overexpression lines with varying COPT4 expression levels, establish whether phenotypic changes correlate with expression levels.

  • Tissue-specific expression: Use tissue-specific promoters to restrict COPT4 overexpression/suppression to specific tissues and observe if phenotypes are localized or systemic.

  • Multi-omics integration: Combine transcriptomics, proteomics, and metabolomics to build causal networks linking COPT4 function to downstream effects.

  • Genetic interaction studies: Create double mutants between COPT4 and other copper homeostasis genes to identify epistatic relationships.

This integrated approach has been successfully employed in studies of other rice transporters like OsNramp5, where researchers systematically analyzed how different mutation positions affected various traits including metal accumulation, yield, and quality .

What are the major challenges in crystallizing membrane proteins like COPT4 and how can they be overcome?

Membrane protein crystallization presents several challenges:

  • Protein stability: COPT4, like other membrane proteins, may be unstable once extracted from the membrane. Consider using protein engineering approaches to improve stability, such as systematic mutagenesis of flexible regions or fusion with crystallization chaperones.

  • Detergent selection: Systematic screening of different detergents is crucial, as the detergent micelle must maintain protein structure while allowing crystal contacts to form.

  • Lipid requirements: Some membrane proteins require specific lipids for stability or function. Consider including these lipids during purification and crystallization trials.

  • Alternative approaches: When traditional crystallization proves challenging, consider newer approaches such as:

    • Lipidic cubic phase (LCP) crystallization

    • Cryo-electron microscopy (cryo-EM)

    • X-ray free-electron laser (XFEL) for micro-crystals

  • Protein production optimization: High-quality protein is essential for crystallization success. Focus on optimizing expression conditions, purification protocols, and sample homogeneity.

Success often requires iterative optimization of multiple parameters simultaneously, with careful attention to protein quality at each step.

How can researchers effectively control for copper contamination in experimental systems studying COPT4?

Copper contamination can significantly impact experimental results:

  • Reagent purity: Use analytical grade reagents with certified metal content. Consider additional purification steps for critical components.

  • Labware considerations: Use plastic labware when possible, as glassware can retain copper. When glass is necessary, treat with EDTA washing followed by acid washing.

  • Water quality: Use ultrapure water systems with final metal-removing cartridges for all solution preparation.

  • Copper speciation controls: Include copper chelators (EDTA, bathocuproine) at defined concentrations to control free copper levels in experimental systems.

  • Background measurements: Regularly measure background copper in your experimental system using sensitive techniques like graphite furnace atomic absorption spectroscopy or ICP-MS.

  • Positive and negative controls: Include copper transport-deficient systems as negative controls and known functional copper transporters as positive controls in transport assays.

These precautions are essential for obtaining reliable and reproducible results when studying copper transport proteins.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.