Recombinant Oryza sativa subsp. japonica Copper transporter 5.1 (COPT5.1)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, but this can be adjusted upon request.
Shelf Life
Shelf life depends on storage conditions, buffer components, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
COPT5.1; Os09g0440700; LOC_Os09g26900; OJ1344_B01.31; Copper transporter 5.1; OsCOPT5.1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-149
Protein Length
full length protein
Species
Oryza sativa subsp. japonica (Rice)
Target Names
COPT5.1
Target Protein Sequence
MMHMTFYWGKDVTILFDGWRTATWTGYLLSLVALLLASAFYQYLEAFRIRVKLLAGAKPA SIPPPASSDAARAPLLLPSSAAGRWPARLATAGLFGVNSGLGYLLMLAVMSFNGGVFVAV VVGLAAGYLAFRSSDGEDLVVVDNPCACA
Uniprot No.

Target Background

Function

Involved in copper transport.

Database Links

KEGG: osa:4347173

STRING: 39947.LOC_Os09g26900.1

UniGene: Os.5955

Protein Families
Copper transporter (Ctr) (TC 1.A.56) family, SLC31A subfamily
Subcellular Location
Membrane; Multi-pass membrane protein.

Q&A

What is the role of COPT5.1 in metal homeostasis in rice?

COPT5.1 is a membrane protein involved in copper (Cu) homeostasis in rice, particularly in relation to metal mobilization across cellular compartments. Based on studies in related systems, COPT5.1 appears to function in the transport of copper ions, likely participating in the mobilization of copper from internal stores such as vacuoles . Studies indicate that COPT5.1 is related to metal homeostasis alongside other metal transporters involved in zinc (Zn) regulation, such as ZIP4 . The protein likely functions as part of a complex network regulating appropriate metal distribution throughout plant tissues.

How does COPT5.1 expression respond to metal availability?

Research indicates that COPT5.1 expression is regulated in response to metal availability, particularly under deficiency conditions. The expression patterns observed in COPT family members suggest that COPT5.1 is part of a coordinated response to copper deficiency . When examining expression profiles under varying metal conditions, COPT5.1 shows altered expression patterns similar to those observed in the related Arabidopsis COPT5 transporter, which exhibits increased expression under copper-limited conditions to enhance mobilization of vacuolar copper stores .

What is the relationship between COPT5.1 and iron homeostasis in plants?

Emerging research demonstrates a significant interconnection between copper and iron (Fe) homeostasis in plants, with COPT5.1 potentially playing a key role in this relationship. Studies with the Arabidopsis COPT5 homolog show that copper transporter mutants display sensitivity to iron deficiency, suggesting functional crosstalk between these metal regulatory systems . Transcriptomic analyses reveal that genes involved in iron transport, including NRAMP4, YSL2, YSL3, and OPT3, show altered expression in copper transporter mutants under copper deficiency conditions . The table below summarizes key genes showing expression changes in response to copper status:

GeneFunctionExpression Change in Cu Deficiency
COPT5.1Copper transportUpregulated
NRAMP4Iron transportUpregulated in copper transporter mutants
YSL2Metal-nicotianamine complex transportSignificantly upregulated (7.97-fold)
YSL3Metal-nicotianamine complex transportUpregulated (2.09-fold)
OPT3Oligopeptide transportUpregulated in copper transporter mutants

What structural and functional characteristics define COPT5.1?

While specific structural details of rice COPT5.1 are not extensively described in the provided literature, inferences can be made based on related COPT family proteins. As a member of the COPT family of high-affinity copper transporters, COPT5.1 likely contains multiple transmembrane domains with metal-binding motifs crucial for copper recognition and transport . The protein's structure would be optimized for selective copper transport across cellular membranes, particularly those of internal organelles like the vacuole. Functional characterization suggests COPT5.1 participates in metal ion mobilization pathways, particularly under deficiency conditions.

What experimental approaches are most effective for studying COPT5.1 function in rice?

Comprehensive investigation of COPT5.1 function requires multiple complementary approaches:

  • Genetic manipulation: Generation of loss-of-function mutants through CRISPR-Cas9 editing or RNAi approaches, along with complementation studies and overexpression lines to confirm phenotypes.

  • Expression analysis: Quantitative RT-PCR and RNA-seq to determine expression patterns across tissues and in response to varying metal status conditions .

  • Protein localization: Fluorescent protein fusions and immunolocalization to determine subcellular localization patterns of COPT5.1.

  • Heterologous expression: Functional complementation assays in yeast mutants deficient in copper transport to validate transport activity.

  • Metal content analysis: ICP-MS (Inductively Coupled Plasma Mass Spectrometry) to quantify metal content in different tissues and cellular compartments of wild-type versus COPT5.1 mutant plants .

  • Global transcriptome analysis: RNA-seq to identify downstream pathways affected by COPT5.1 disruption, as demonstrated in the comparative microarray analysis approach used with Arabidopsis COPT5 .

How can researchers differentiate between the functions of COPT5.1 and COPT5.2 in rice?

Distinguishing the specific functions of closely related transporters requires targeted strategies:

  • Phylogenetic analysis: Comprehensive evolutionary analysis to determine the relationship between COPT5.1 and COPT5.2, which provides context for functional divergence.

  • Isoform-specific knockouts: Generate single and double mutants using precision genome editing to assess individual and redundant functions.

  • Tissue-specific expression patterns: Detailed analysis of expression domains using promoter-reporter constructs to identify spatial and temporal differences in expression.

  • Subcellular localization studies: Determine whether COPT5.1 and COPT5.2 localize to different cellular compartments, which would suggest distinct functions in metal homeostasis networks.

  • Metal specificity assays: In vitro transport assays to determine whether the transporters have different metal preferences or kinetic properties.

  • Physiological phenotyping: Compare growth responses of specific mutant lines under various metal stress conditions to identify functional specialization.

What strategies are recommended for investigating COPT5.1's role in metal crosstalk?

Based on the established interconnection between copper and iron homeostasis involving COPT family transporters , several strategies are recommended:

  • Multi-metal experimental design: Design experiments with systematic variation in both copper and iron availability to identify interaction effects.

  • Transcriptomic profiling: Analyze expression changes in both copper and iron homeostasis genes under various metal regimes in wild-type and COPT5.1 mutant backgrounds.

  • Double mutant analysis: Generate and characterize plants with mutations in both COPT5.1 and key iron transporters (e.g., NRAMP4) to assess genetic interactions .

  • Metal content analysis: Quantify multiple metals simultaneously in different tissues and subcellular compartments to identify compensatory mechanisms.

  • Protein interaction studies: Investigate potential physical interactions between COPT5.1 and components of the iron homeostasis machinery.

  • Vacuolar metal pool analysis: Given that COPT5 in Arabidopsis functions in vacuolar copper export, analyze how COPT5.1 disruption affects vacuolar metal sequestration and mobilization .

What approaches can resolve contradictory data regarding COPT5.1 function?

When confronted with inconsistent experimental results:

  • Standardized growth conditions: Implement rigorously controlled growth conditions, as metal homeostasis is highly sensitive to environmental variables.

  • Genetic background verification: Ensure all comparative studies use identical genetic backgrounds to eliminate confounding variation.

  • Developmental stage consideration: Analyze COPT5.1 function across multiple developmental stages, as metal requirements change throughout the plant life cycle.

  • Environmental interaction assessment: Evaluate how different environmental factors might interact with COPT5.1 function, potentially explaining contradictory observations.

  • Independent methodological validation: Apply multiple independent techniques to validate key findings, particularly when results appear inconsistent.

  • Tissue-specific analysis: Resolve whole-plant level contradictions by examining tissue-specific effects that might average out at the organism level.

What are optimal conditions for expressing recombinant COPT5.1 protein for research applications?

For successful production of functional recombinant COPT5.1:

  • Expression system selection: For membrane proteins like COPT5.1, eukaryotic expression systems such as yeast or insect cells generally yield better results than bacterial systems due to appropriate membrane composition and post-translational processing capabilities.

  • Codon optimization: Optimize codon usage for the chosen expression system to enhance translation efficiency while maintaining proper protein folding.

  • Affinity tag selection: Incorporate purification tags (His6, GST, etc.) at positions least likely to interfere with transport function, preferably with a cleavable linker.

  • Detergent screening: For membrane protein extraction, screen multiple detergents to identify optimal solubilization conditions that maintain protein structure and function.

  • Expression conditions optimization: Determine ideal induction parameters (temperature, inducer concentration, duration) through small-scale expression trials monitored by Western blotting.

  • Functional validation: Verify that recombinant protein retains copper binding and transport capabilities through functional assays.

What methodologies are recommended for measuring COPT5.1-mediated copper transport?

To accurately quantify transport activity:

  • Reconstitution systems: Incorporate purified protein into liposomes and measure copper uptake using radioactive tracers (64Cu) or copper-specific fluorescent indicators.

  • Yeast complementation assays: Express COPT5.1 in copper transport-deficient yeast strains and assess growth rescue under copper limitation.

  • Electrophysiological approaches: Apply patch-clamp techniques to measure transport-associated currents in heterologous expression systems.

  • In vivo imaging: Utilize copper-specific fluorescent sensors targeted to appropriate cellular compartments to visualize dynamic changes in copper distribution.

  • Metal accumulation analysis: Measure compartment-specific copper content in wild-type versus COPT5.1 mutant plants using sensitive analytical techniques like ICP-MS .

How can researchers accurately assess metal specificity and kinetics of COPT5.1?

To characterize transport properties:

  • Competition assays: Measure transport rates in the presence of various competing metals to determine selectivity profiles.

  • Dose-response analysis: Determine transport kinetics by measuring activity across a range of substrate concentrations to establish Km and Vmax values.

  • Site-directed mutagenesis: Modify predicted metal-binding residues to identify determinants of metal specificity and affinity.

  • Transport assays under varying conditions: Assess transport activity under different pH, temperature, and membrane potential conditions to understand physiological regulation.

  • Binding studies: Employ isothermal titration calorimetry (ITC) or microscale thermophoresis (MST) to measure direct metal binding affinities.

  • Structural modeling: Develop homology models based on related transporters to predict metal coordination sites and transport mechanisms.

How does COPT5.1 function in the broader context of plant stress responses?

Current research indicates copper transporters play roles beyond basic metal homeostasis:

  • Oxidative stress response: COPT5.1 likely contributes to oxidative stress management, as copper is an essential cofactor in antioxidant enzymes like superoxide dismutase.

  • Hormone signaling interaction: Evidence from related systems suggests interconnections between metal transport and hormone signaling pathways, particularly ethylene, as indicated by transcriptomic studies of COPT5 in Arabidopsis .

  • Biotic stress resistance: Copper homeostasis contributes to pathogen defense mechanisms, suggesting COPT5.1 may indirectly influence plant immunity.

  • Abiotic stress tolerance: Metal transport systems often show altered regulation under environmental stresses like drought or salinity, suggesting COPT5.1 may participate in broader stress adaptation networks.

What insights can comparative genomics provide about COPT5.1 evolution and function?

Evolutionary analysis reveals important functional contexts:

  • Conservation patterns: Analysis of COPT family members across rice varieties and related species like O. rufipogon, O. barthii, and O. longistaminata reveals patterns of conservation that highlight functionally critical domains .

  • Synteny analysis: Investigation of the genomic regions containing COPT transporters shows varying degrees of collinearity between species, providing insights into evolutionary history and functional divergence .

  • Expression pattern conservation: Comparison of expression patterns in response to metal deficiency across related species suggests conservation of regulatory mechanisms, as shown with other metal transporters like IRT1, YSL15, and NRAMP1 .

  • Functional complementation: Cross-species complementation studies can reveal functional equivalence or specialization between homologs.

What role might COPT5.1 play in biofortification strategies for rice improvement?

Potential applications in crop improvement include:

  • Micronutrient enhancement: Modulation of COPT5.1 expression or activity could potentially increase copper content in edible tissues, though careful consideration of potential tradeoffs is necessary.

  • Stress tolerance improvement: Given the relationships between metal homeostasis and stress responses, optimizing COPT5.1 function might enhance performance under marginal growing conditions.

  • Metal homeostasis network engineering: Coordinated modification of multiple transporters, including COPT5.1, could create more efficient nutrient acquisition and utilization systems.

  • Tissue-specific metal distribution: Targeted expression of COPT5.1 variants could redirect metal allocation to specific tissues or developmental stages.

What experimental systems best represent COPT5.1 function in agricultural contexts?

To ensure research relevance:

  • Field-relevant conditions: Evaluate COPT5.1 function under realistic field conditions rather than optimal laboratory environments to better predict agricultural performance.

  • Soil-based systems: Study metal transport in soil-grown plants rather than hydroponic systems when possible, as metal bioavailability differs significantly.

  • Genotype diversity sampling: Test COPT5.1 function across diverse rice genotypes to understand how genetic background influences transporter activity.

  • Long-term studies: Assess the impacts of COPT5.1 modification across complete growing seasons and multiple generations to identify potential developmental or reproductive effects.

  • Integration with breeding programs: Combine molecular characterization with traditional breeding approaches to develop improved varieties with optimized metal homeostasis traits.

How should researchers interpret transcriptomic data related to COPT5.1 function?

Robust transcriptomic analysis requires:

  • Appropriate experimental design: Include relevant controls and biological replicates when designing transcriptomic experiments analyzing COPT5.1 function.

  • Rigorous statistical analysis: Apply suitable statistical methods, as demonstrated in the Arabidopsis COPT5 study where ANOVA with FDR ≤ 0.01 was used to identify differentially expressed genes .

  • Validation of key findings: Confirm transcriptomic results for key genes using RT-qPCR, as shown in the validation approach for copper-responsive genes in the COPT5 study .

  • Pathway and Gene Ontology analysis: Use GO analysis to identify biological processes affected by COPT5.1 disruption, similar to the approach that identified enrichment of metal ion transport processes in the Arabidopsis study .

  • Cross-species comparisons: Compare transcriptomic responses to metal deficiency across related species to identify conserved regulatory networks .

What statistical approaches are most appropriate for analyzing metal content data in COPT5.1 studies?

For rigorous metal analysis:

  • Normalization strategies: Normalize metal content data to appropriate parameters (dry weight, protein content, etc.) depending on the specific question being addressed.

  • Appropriate statistical tests: Select statistical tests based on data distribution and experimental design, using non-parametric tests when assumptions of normality are not met.

  • Correlation analysis: Apply correlation analyses to identify relationships between different metals and between metal content and physiological parameters.

  • Multi-factor analysis: Use multivariate approaches when analyzing the effects of multiple variables (e.g., genotype, metal treatment, tissue type) on metal content.

  • Data visualization: Develop clear visualization strategies to effectively communicate complex metal distribution patterns.

The relationship between COPT5.1 and other metal transporters is further illustrated by expression data from copper deficiency experiments in related systems, as shown in the following table:

GeneDescriptionFold Change Under Cu Deficiency
COPT2Copper transporter 23.27
CCHCopper chaperone2.84
YSL2YELLOW STRIPE like 27.97
YSL3YELLOW STRIPE like 32.09
HMA2Heavy metal ATPase 22.16
NRAMP4Natural resistance associated macrophage protein 41.27

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.