Recombinant Oryza sativa subsp. japonica Copper transporter 6 (COPT6)

Shipped with Ice Packs
In Stock

Description

Subcellular Localization and Regulation

COPT6 resides at the plasma membrane, suggesting its role in Cu uptake from the extracellular space . Studies using FM 4-64 dye, an endocytic marker, confirm its plasma membrane localization . The expression of COPT6 is regulated by Cu availability, with increased transcript levels observed under Cu-deficient conditions . The transcription factor SPL7, a master regulator of Cu homeostasis, also controls COPT6 expression .

Functional Studies and Copper Homeostasis

COPT6 functions in Cu homeostasis in Arabidopsis . It mediates copper accumulation when expressed in the Saccharomyces cerevisiae copper uptake mutant . The N-terminal domain is dispensable for COPT6 function in copper-replete conditions but is important under copper-limiting conditions . COPT6 interacts with itself and with its homolog, COPT1 . Mutant plants lacking COPT6 exhibit altered Cu distribution under Cu-deficient conditions, including increased Cu in rosette leaves but reduced Cu levels in seeds . Reintroducing the wild-type COPT6 gene into the copt6 mutant line restores normal Cu distribution .

Role in Copper Distribution

COPT6 plays a role in shoot Cu redistribution when environmental Cu is limited . It is expressed in aerial vascular tissues and reproductive organs .

Interactions with Other Proteins

COPT6 interacts with itself and COPT1, unlike Ctr1p, which only interacts with itself .

Expression Analysis

COPT6 is expressed in different cell types of different plant organs, with the bulk of its expression located in the vasculature . COPT6 transcript is expressed under Cu excess conditions and displays a more gradual increase in response to decreases in environmental Cu levels . Exposure to gold (Au) significantly reduces COPT6 mRNA levels in the root and shoot after 2 days .

Mutant Studies

Arabidopsis copt6-1 mutant plants and plants overexpressing COPT6 reveal its essential role during copper limitation and excess . COPT6 mutant plants exhibit altered Cu distribution under Cu-deficient conditions, including increased Cu in rosette leaves but reduced Cu levels in seeds .

Table Summarizing COPT6 Characteristics

FeatureDescription
GeneCOPT6
Protein FamilyCTR/COPT copper transporters
LocalizationPlasma membrane
RegulationCopper availability, SPL7 transcription factor
FunctionCopper uptake and distribution, copper homeostasis
Mutant PhenotypeAltered copper distribution under copper-deficient conditions (increased copper in rosette leaves, reduced copper in seeds)
InteractionsSelf-interaction, interaction with COPT1
Expression PatternExpressed in various cell types and plant organs, predominantly in vasculature. Transcript expressed under copper excess conditions and increases gradually in response to decreasing copper levels.
ComplementationFully complements yeast mutants defective in high-affinity copper uptake

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on several factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during the production process. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
COPT6; Os04g0415600; LOC_Os04g33900; OJ991214_12.9; Copper transporter 6; OsCOPT6
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-184
Protein Length
full length protein
Species
Oryza sativa subsp. japonica (Rice)
Target Names
COPT6
Target Protein Sequence
MRGMGDDGMGPMAMAPPRSGHATAAAPPPPQHKMAMMMHMTFFWSDRAVVLIRGWPGERG AGMYALCLLFVLALAALTEGLSVLSRRLARRGGGAASSDGGRPAPAPASSAALLTAVHAA RMGMAYLVMLAVMSFNVGVLLAAVAGHALGFLLARSRVRPAARDGGGGVACEHGGLPPAD GSKT
Uniprot No.

Target Background

Function
Involved in copper transport.
Database Links
Protein Families
Copper transporter (Ctr) (TC 1.A.56) family, SLC31A subfamily
Subcellular Location
Membrane; Multi-pass membrane protein.

Q&A

What is the basic function of COPT6 in Oryza sativa?

COPT6 functions as a plasma membrane copper transport protein that plays a crucial role in copper homeostasis in rice. Similar to its Arabidopsis counterpart, rice COPT6 likely mediates high-affinity copper uptake across the plasma membrane, facilitating copper acquisition particularly during copper limitation. The transporter belongs to the CTR/COPT family of copper transporters that are highly conserved across plant species, with rice containing seven COPT members that contribute to copper uptake and transport throughout the plant .

How does COPT6 structure differ between Arabidopsis and Oryza sativa?

While both transporters share conserved domains including methionine-rich motifs in the extracellular N-terminal domain and a second transmembrane helix (TM2), rice COPT6 may exhibit species-specific structural adaptations. In Arabidopsis, COPT6 contains positionally conserved methionine residues (e.g., Met106 in TM2) that are functionally essential, while others (e.g., Met27 in the N-terminal domain) are not critical for function. Structure-function analyses in Arabidopsis have shown that the N-terminal domain is dispensable under copper-replete conditions but becomes important under copper limitation . Researchers examining rice COPT6 should investigate whether these structural features are conserved or if rice-specific adaptations exist.

What expression pattern does COPT6 exhibit in rice tissues?

Based on comparative analysis with Arabidopsis COPT6, rice COPT6 likely shows tissue-specific expression patterns with predominant expression in vascular tissues. Expression analysis methods should include quantitative RT-PCR across different rice tissues and developmental stages, as well as promoter-reporter fusion constructs to visualize tissue-specific expression patterns. In Arabidopsis, COPT6 is expressed in different cell types across various plant organs, with highest expression in the vasculature, suggesting a role in long-distance copper transport . Rice-specific expression patterns should be determined experimentally to understand potential functional differences.

What are the optimal methods for cloning and expressing recombinant Oryza sativa COPT6?

For successful recombinant expression of rice COPT6, researchers should:

  • Isolate total RNA from rice tissues with verified COPT6 expression

  • Perform RT-PCR using gene-specific primers with appropriate restriction sites or Gateway recombination sites

  • Clone the amplified cDNA into expression vectors suitable for protein production systems (e.g., bacterial, yeast, insect, or plant expression systems)

  • For functional studies, express in yeast copper uptake mutants (e.g., S. cerevisiae ctr1Δ ctr3Δ) as demonstrated for Arabidopsis COPT transporters

  • For localization studies, create GFP fusion constructs with COPT6 with or without its stop codon using recombination cloning methods

  • For structure-function analyses, perform site-directed mutagenesis to modify conserved methionine residues using established mutagenesis protocols

Heterologous expression in S. cerevisiae mutants provides a clean system for functional characterization, while expression in plant protoplasts or stable transgenic plants allows for physiological studies.

What techniques are most effective for analyzing COPT6 protein interactions in rice?

To investigate COPT6 protein interactions:

  • Yeast two-hybrid (Y2H) assays: Screen for interacting partners using a rice cDNA library with COPT6 as bait

  • Split-ubiquitin membrane yeast two-hybrid: More appropriate for membrane proteins like COPT6

  • Bimolecular fluorescence complementation (BiFC) in rice protoplasts to confirm interactions in planta

  • Co-immunoprecipitation (Co-IP) using epitope-tagged COPT6 expressed in rice

  • Mass spectrometry analysis of purified COPT6 complexes

Based on studies of Arabidopsis COPT6, researchers should specifically examine interactions with other COPT family members, as COPT6 has been shown to interact with itself (homodimerization) and with COPT1 (heterodimerization) . These interactions may be critical for transporter function and regulation.

How can subcellular localization of COPT6 be accurately determined in rice cells?

For definitive subcellular localization:

  • Fluorescent protein fusions: Generate N- and C-terminal GFP-COPT6 fusion constructs

  • Transient expression in rice protoplasts for rapid analysis

  • Stable transformation in rice for in situ localization

  • Co-localization studies with established membrane markers (plasma membrane, tonoplast, ER, etc.)

  • Immunogold electron microscopy using COPT6-specific antibodies for high-resolution localization

  • Membrane fractionation followed by western blotting to biochemically confirm localization

Research in Arabidopsis indicates that COPT6 localizes to the plasma membrane , but rice-specific localization should be confirmed as functional differences may exist between species.

How is COPT6 expression regulated in response to copper availability in rice?

COPT6 expression in rice likely responds to copper status through mechanisms similar to those in Arabidopsis:

  • Transcriptional regulation: Expression is likely upregulated during copper deficiency and downregulated under copper excess

  • SPL transcription factors: The rice homolog of SPL7 (a master regulator of copper homeostasis) likely controls COPT6 expression

  • CURE elements: The COPT6 promoter should be analyzed for copper-responsive elements (CuREs) that are binding sites for SPL transcription factors

  • miRNA regulation: Examine potential post-transcriptional regulation by microRNAs

To study this regulation:

  • Perform qRT-PCR analysis of COPT6 expression under varying copper concentrations

  • Analyze COPT6 promoter activity using reporter gene constructs

  • Investigate SPL binding to the COPT6 promoter using chromatin immunoprecipitation (ChIP)

  • Examine COPT6 expression in rice spl mutants

The copper-responsive regulation observed in other COPT family members suggests that COPT6 expression would similarly be regulated by copper availability .

What role does the SPL9 transcription factor play in regulating COPT6 in rice?

In rice, SPL9 appears to be involved in copper homeostasis through its inhibition by copper, which affects miR528 transcription . To investigate SPL9's specific role in COPT6 regulation:

  • Analyze COPT6 expression levels in spl9 mutant rice plants under varying copper conditions

  • Perform ChIP assays to determine if SPL9 directly binds to the COPT6 promoter

  • Use dual-luciferase reporter assays with the COPT6 promoter and SPL9 protein under different copper concentrations

  • Examine SPL9 protein levels in response to copper using western blotting

  • Investigate potential interactions between SPL9 and other factors involved in copper homeostasis

Research has shown that copper suppresses SPL9 protein levels, affecting downstream targets . Whether COPT6 is directly regulated by SPL9 or other SPL family members in rice requires further investigation.

How does COPT6 contribute to copper homeostasis during plant development?

To investigate COPT6's role in rice development:

  • Generate and characterize copt6 knockout mutants using CRISPR/Cas9 gene editing

  • Create COPT6 overexpression lines under native or constitutive promoters

  • Analyze phenotypes under varying copper conditions throughout the plant life cycle

  • Measure copper content in different tissues using ICP-MS or ICP-OES

  • Examine expression of copper-responsive genes in wild-type vs. mutant plants

  • Investigate developmental defects in reproductive tissues, as vascular expression suggests a role in copper transport to developing tissues

Arabidopsis studies indicate COPT6 plays essential roles during both copper limitation and excess , suggesting rice COPT6 may similarly be critical for maintaining copper homeostasis during key developmental stages.

What is the relationship between COPT6 function and viral resistance in rice?

Research has shown that copper transport proteins contribute to viral resistance in rice:

  • Loss-of-function mutations in copper transporters (HMA5, COPT1, COPT5) reduce copper accumulation and virus resistance

  • Rice promotes copper accumulation in shoots by inducing copper transporter genes to counteract viral infection

  • Copper suppresses miR528 transcription by inhibiting SPL9, strengthening antiviral responses

To investigate COPT6's specific role:

  • Challenge copt6 mutants with rice viruses (e.g., Rice stripe virus) and assess disease progression

  • Measure copper distribution in subcellular compartments during viral infection

  • Analyze the expression of defense-related genes in wild-type vs. copt6 mutants

  • Examine if COPT6 overexpression enhances viral resistance

Understanding COPT6's contribution to copper-mediated viral resistance could provide new strategies for enhancing rice disease resistance.

How does COPT6-mediated copper transport interact with iron homeostasis in rice?

A complex interaction exists between copper and iron homeostasis in plants:

  • Copper status affects the expression of genes involved in iron homeostasis in rice

  • Under copper excess, iron regulators like OsIRO2 and nicotianamine synthase OsNAS2 are upregulated, while ferritin OsFER2 is downregulated

  • Altered copper transport (through COPT overexpression) affects iron-sensing factors like OsHRZ1 and OsHRZ2

To study COPT6's role in copper-iron crosstalk:

  • Analyze iron content in copt6 mutants and overexpression lines

  • Examine expression of iron homeostasis genes in these genotypes

  • Grow plants under varying copper and iron conditions to identify interactions

  • Investigate grain nutrient content, as Arabidopsis COPT1 overexpression increases iron in rice grains

This research direction could yield insights for biofortification strategies to optimize both copper and iron content in rice grains.

What structural features distinguish rice COPT6 from other COPT family members?

To investigate the unique structural features of rice COPT6:

  • Perform comprehensive sequence alignment of all seven rice COPT proteins

  • Identify conserved and divergent motifs, particularly in:

    • Methionine-rich N-terminal domains

    • Transmembrane domains

    • C-terminal regions

  • Conduct structure-function analyses through targeted mutagenesis of key residues

  • Generate protein structure predictions using AlphaFold or similar tools

  • Examine evolutionary conservation across monocots and dicots

For functional verification:

  • Express wild-type and mutated versions in yeast copper uptake mutants

  • Test complementation under varying copper concentrations

  • Assess protein-protein interactions of different COPT members

Since Arabidopsis COPT6 shows functional differences from the founding family member S. cerevisiae Ctr1p, particularly in the requirement of specific methionine residues , rice COPT6 may possess unique structural adaptations that reflect its specialized function in monocots.

What approaches can resolve contradictory data regarding subcellular copper distribution during stress responses?

Research has shown complex changes in copper distribution during stress responses:

  • Virus infection increases total shoot copper content by up to 25%

  • Contradictorily, copper levels decrease in intercellular spaces but increase within cells

  • Subcellular distribution shows reduced copper in chloroplasts but increased levels in intracellular spaces

To resolve these apparent contradictions:

  • Use complementary techniques for copper measurement (ICP-OES, XRF, TEM-EDS)

  • Develop subcellular-targeted copper sensors for real-time monitoring

  • Employ cell fractionation techniques with rigorous controls

  • Analyze copper speciation (Cu⁺/Cu²⁺) alongside total copper measurements

  • Compare different stress conditions (biotic vs. abiotic)

  • Investigate tissue-specific responses

Understanding these complex copper redistribution patterns could reveal how COPT6 and other transporters orchestrate copper mobilization during stress responses.

How can synthetic biology approaches enhance COPT6 function for improved crop resilience?

Advanced synthetic biology strategies could engineer enhanced COPT6 function:

  • Promoter engineering: Design synthetic copper-responsive promoters with optimized SPL binding sites

  • Protein engineering: Modify methionine-rich motifs for improved copper affinity or transport kinetics

  • Subcellular targeting: Add targeting sequences to redirect COPT6 to specific compartments

  • Conditional expression systems: Develop stress-inducible COPT6 expression to enhance specific stress responses

  • Chimeric transporters: Create fusion proteins combining domains from different COPT family members

Potential applications include:

  • Enhanced disease resistance through optimized copper distribution

  • Improved nutrient use efficiency under limiting conditions

  • Biofortification strategies for increased micronutrient content in grains

  • Phytoremediation capabilities for copper-contaminated soils

These approaches require thorough understanding of structure-function relationships and careful phenotypic assessment of engineered plants.

Methodological Table for COPT6 Research

Research AspectMethodologyKey ConsiderationsExpected Outcomes
Gene CloningRT-PCR from rice tissues; Gateway cloningRNA quality; primer design; vector selectionFull-length COPT6 cDNA in expression vectors
Protein ExpressionHeterologous expression in yeast, E. coli, or plant systemsExpression levels; protein solubility; purification tagsFunctional recombinant COPT6 protein
Functional AnalysisYeast complementation assays; ⁶⁴Cu uptake measurementsCu concentration; growth conditions; controlsTransport kinetics; substrate specificity
Localization StudiesFluorescent protein fusions; confocal microscopyTag position; expression level; co-localization markersSubcellular distribution patterns
Protein InteractionsY2H; BiFC; Co-IP; mass spectrometryBait/prey constructs; controls; detection sensitivityIdentification of interaction partners
Mutant AnalysisCRISPR/Cas9 gene editing; T-DNA insertionsOff-target effects; complementation testingPhenotypic characterization of loss-of-function
Expression AnalysisqRT-PCR; RNA-seq; promoter-reporter fusionsReference genes; developmental stages; stress conditionsSpatiotemporal expression patterns
Metal Content AnalysisICP-MS; ICP-OES; XRF; TEM-EDSSample preparation; calibration; detection limitsQuantitative metal distribution data
Structure-FunctionSite-directed mutagenesis; deletion analysisTarget residue selection; expression verificationCritical residues for COPT6 function
Stress Response StudiesPathogen infection; abiotic stress treatmentsStress intensity; timing; physiological markersCOPT6 contribution to stress tolerance

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.