Recombinant Oryza sativa subsp. japonica Cytochrome b5 (Os05g0108800, LOC_Os05g01820)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is finalized during production. To request a specific tag, please inform us, and we will prioritize its inclusion.
Synonyms
Os05g0108800; LOC_Os05g01820; OsJ_16839; OSJNBa0068N01.16; Cytochrome b5
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-137
Protein Length
full length protein
Species
Oryza sativa subsp. japonica (Rice)
Target Names
Os05g0108800
Target Protein Sequence
MSNDNKKVYTLEEVAKHNSKDDCWLIIGGKVYNVSKFLEDHPGGDDVLLSSTGKDATDDF EDVGHSTTARAMMDEYYVGDIDTSTIPARTKYVPPKQPHYNQDKTPEFIIKILQFLVPLA ILGLAVAIRIYTKSESA
Uniprot No.

Target Background

Function

Membrane-bound hemoprotein functioning as an electron carrier for various membrane-bound oxygenases.

Database Links

KEGG: osa:4337583

STRING: 39947.LOC_Os05g01820.1

UniGene: Os.3430

Protein Families
Cytochrome b5 family
Subcellular Location
Endoplasmic reticulum membrane; Single-pass membrane protein; Cytoplasmic side. Microsome membrane; Single-pass membrane protein; Cytoplasmic side.

Q&A

What is the cellular localization of Oryza sativa Cytochrome b5 (Os05g0108800)?

Oryza sativa Cytochrome b5 (OsCYB5-2) is primarily localized to the endoplasmic reticulum (ER) in plant cells. This localization can be experimentally determined through fluorescent protein tagging and confocal microscopy. When OsCYB5-2 is fused with green fluorescence protein (GFP) to produce GFP-OsCYB5-2, it displays a characteristic reticular morphology that overlaps with the fluorescence pattern of known ER markers such as HDEL tagged with mCherry .

To confirm this localization, researchers should use co-localization studies with established ER markers. The protocol involves:

  • Generating GFP-OsCYB5-2 fusion constructs under a constitutive promoter

  • Co-transforming with an ER marker (such as mCherry-HDEL)

  • Transiently expressing these constructs in rice protoplasts or tobacco leaves

  • Visualizing using confocal microscopy with appropriate excitation wavelengths for GFP and mCherry

  • Calculating co-localization coefficients to quantify the degree of overlap

This reticular ER localization is consistent with the function of many cytochrome b5 proteins, which commonly anchor to the ER via C-terminal hydrophobic domains while their hydrophilic N-terminal domains protrude into the cytosol .

What expression patterns does OsCYB5-2 exhibit in rice tissues?

OsCYB5-2 demonstrates ubiquitous expression across all rice tissues, suggesting its fundamental importance in cellular processes. The expression pattern can be analyzed using both transcriptional and translational reporter systems.

Using the OsCYB5-2 promoter fused to a GUS (β-glucuronidase) reporter gene, strong expression signals can be detected in most cell types across different tissues . Cross-sections of GUS-stained roots reveal particularly strong signals in xylem parenchyma and endodermal cells, which are critical for ion transport . Additionally, significant GUS activity driven by the OsCYB5-2 promoter is detectable in germinating embryos, suggesting developmental roles during early growth stages .

The expression pattern of OsCYB5-2 notably overlaps spatially and temporally with that of OsHAK21, a potassium transporter with which it physically interacts . This co-expression pattern provides supporting evidence for their functional relationship in planta.

For researchers studying OsCYB5-2 expression, quantitative PCR analysis coupled with tissue-specific sampling provides the most comprehensive approach to characterize expression patterns under various developmental stages and stress conditions.

How can protein-protein interactions involving OsCYB5-2 be detected and verified?

Multiple complementary approaches should be employed to robustly establish protein-protein interactions involving OsCYB5-2:

  • Yeast Split-Ubiquitin System: This technique is particularly useful for membrane-associated proteins. For OsCYB5-2, researchers have successfully detected interactions with OsHAK21 using this system . The protocol involves:

    • Fusing OsCYB5-2 to the N-terminal half of yeast ubiquitin (NubG)

    • Fusing the potential interacting partner (e.g., OsHAK21) to the C-terminal half of ubiquitin (Cub)

    • Co-expressing these constructs in yeast

    • Assessing growth on selective media and measuring β-galactosidase activity

  • Co-immunoprecipitation (Co-IP): This approach verifies interactions in plant cells. For OsCYB5-2:

    • Generate constructs with epitope tags (e.g., HA-OsCYB5-2 and OsHAK21-FLAG)

    • Co-express in tobacco leaves via Agrobacterium-mediated transformation

    • Extract proteins under non-denaturing conditions

    • Perform immunoprecipitation with anti-FLAG antibodies

    • Detect co-precipitated proteins by western blotting with anti-HA antibodies

  • Förster Resonance Energy Transfer (FRET): This technique provides in vivo evidence of close molecular proximity. For OsCYB5-2:

    • Generate fluorescent protein fusions (YFP-OsCYB5-2 and OsHAK21-CFP)

    • Co-express in rice protoplasts

    • Measure FRET efficiency using acceptor photobleaching or sensitized emission

    • Compare FRET signals with appropriate negative controls (e.g., YFP-HDEL)

The OsCYB5-2 and OsHAK21 interaction has been confirmed using all three methods, with FRET signals 4.5-fold higher than the negative control, providing strong evidence for their specific interaction in vivo .

How does the OsCYB5-2–OsHAK21 interaction alter potassium transport kinetics?

The interaction between OsCYB5-2 and OsHAK21 significantly enhances potassium transport activity through two key mechanisms: increasing the maximum transport rate (Vmax) and decreasing the Michaelis constant (Km). This biochemical enhancement can be quantified through radioactive tracer studies using 86Rb+ (a potassium analogue) in various expression systems.

In Arabidopsis athak5 mutants (deficient in high-affinity K+ uptake), co-expression of OsHAK21 with OsCYB5-2 results in superior growth compared to lines expressing OsHAK21 alone when grown under low potassium conditions (5-10 μM K+) . This improved growth manifests as increased root length and fresh weight compared to control plants .

Direct measurements of potassium uptake kinetics using 86Rb+ tracers reveal:

Expression SystemKm (μM)Vmax (nmol/min/g)Relative Efficiency
Wild-type plants15±247±31.0
athak5 mutant143±1222±20.05
athak5/OsHAK2125±338±30.49
athak5/OsHAK21/OsCYB5-216±245±30.90
athak5/OsCYB5-2142±1023±20.05

These kinetic parameters demonstrate that OsCYB5-2 enhances OsHAK21-mediated potassium transport by increasing the apparent affinity for potassium (lower Km) and the maximum transport rate (higher Vmax) . Importantly, overexpression of OsCYB5-2 alone does not alter potassium uptake parameters, indicating that the enhanced transport activity specifically requires OsHAK21-OsCYB5-2 interaction .

For researchers investigating this interaction, combining electrophysiological approaches (patch-clamp) with heterologous expression systems (Xenopus oocytes) would provide additional mechanistic insights into how the interaction modifies channel properties at the molecular level.

What methods can be used to analyze the electron transfer properties of recombinant OsCYB5-2?

Analysis of electron transfer properties for recombinant OsCYB5-2 requires a multi-faceted approach:

  • Spectroscopic Characterization: UV-visible spectroscopy can be used to monitor the redox state of the heme group in OsCYB5-2. The oxidized and reduced forms have distinctive absorption spectra with characteristic peaks at approximately 413 nm (oxidized, Soret band) and 423 nm (reduced) . The protocol involves:

    • Purifying recombinant OsCYB5-2 protein with the intact heme group

    • Recording baseline spectra of the oxidized form

    • Adding reducing agents (e.g., sodium dithionite) to generate the reduced form

    • Monitoring spectral shifts to confirm proper folding and heme incorporation

  • Cytochrome P450 Reduction Assays: As cytochrome b5 proteins commonly function as electron donors to cytochrome P450 enzymes, reconstitution assays can assess functional electron transfer. Similar to how viral cytochrome b5 can reduce eukaryotic cytochrome P450 enzymes , OsCYB5-2 can be tested for its ability to transfer electrons to various P450 partners by:

    • Setting up an in vitro system with purified OsCYB5-2, a cytochrome P450, and NADPH-cytochrome P450 reductase

    • Measuring cytochrome P450 activity with and without OsCYB5-2

    • Calculating the enhancement in reaction rates attributable to OsCYB5-2

  • Electrochemical Measurements: Cyclic voltammetry can determine the redox potential of OsCYB5-2, which influences its electron transfer capabilities. The protocol includes:

    • Immobilizing purified OsCYB5-2 on an electrode surface

    • Performing cyclic voltammetry scans

    • Determining the midpoint potential (Em) under various pH conditions

    • Comparing with known cytochrome b5 proteins from other species

These methodologies provide comprehensive insights into the electron transfer properties of OsCYB5-2, which are essential for understanding its role in metabolic pathways and protein-protein interactions.

How can OsCYB5-2 be engineered to enhance salt stress tolerance in crops?

Engineering enhanced salt stress tolerance through OsCYB5-2 requires targeted genetic approaches based on a thorough understanding of its role in counteracting sodium toxicity:

  • Overexpression Strategy: The co-expression of OsCYB5-2 with OsHAK21 has been shown to improve potassium uptake efficiency . This approach can be implemented by:

    • Creating expression constructs with both genes under strong constitutive or stress-inducible promoters

    • Using Agrobacterium-mediated transformation to generate transgenic rice lines

    • Screening transformants for increased expression levels of both proteins

    • Assessing salt tolerance through physiological, biochemical, and growth parameters under controlled stress conditions

  • Protein Engineering Approach: Enhancing the interaction between OsCYB5-2 and OsHAK21 could further improve salt tolerance. Researchers could:

    • Conduct alanine scanning mutagenesis to identify critical residues at the interaction interface

    • Design mutations that strengthen protein-protein interactions based on structural models

    • Analyze the effects of these mutations on potassium transport kinetics

    • Test engineered variants in planta under salt stress conditions

  • Translational Applications to Other Crops: The OsCYB5-2 enhancement strategy can potentially be extended to other agriculturally important crops by:

    • Identifying orthologous HAK/KUP/KT transporters and cytochrome b5 proteins in target crops

    • Assessing their interaction potential through homology modeling and in vitro assays

    • Creating crop-specific gene constructs for co-expression

    • Evaluating transgenic lines under saline field conditions

The effectiveness of these approaches should be evaluated using comprehensive phenotyping, including:

  • K+/Na+ ratio measurements in different tissues

  • Membrane potential recordings in root cells

  • Reactive oxygen species quantification

  • Yield components under salt stress

  • Transcriptomic and metabolomic profiling to identify downstream effects

What is the evolutionary relationship between rice cytochrome b5 and viral cytochrome b5 proteins?

The evolutionary relationship between plant and viral cytochrome b5 proteins presents an intriguing research area. Viral cytochrome b5 genes have been identified in several taxa of the Megavirales order and in viruses infecting green algae . Comparative analysis reveals several interesting patterns:

To investigate evolutionary relationships between rice and viral cytochrome b5 proteins, researchers should:

  • Conduct comprehensive phylogenetic analysis using:

    • Maximum likelihood and Bayesian inference methods

    • Selection of appropriate evolutionary models

    • Bootstrap validation of tree topology

  • Perform structural comparisons through:

    • Homology modeling of OsCYB5-2 structure

    • Superposition with known viral cytochrome b5 structures

    • Calculation of root-mean-square deviation (RMSD) values

    • Analysis of conserved functional domains

  • Assess functional conservation via:

    • Heterologous expression of viral cytochrome b5 in rice

    • Complementation assays with OsCYB5-2 knockout lines

    • Analysis of protein-protein interaction capabilities

Such comparative analyses would provide insights into the origin and evolution of these important electron transport proteins across diverse life forms and could potentially identify novel functional properties applicable to rice improvement.

What are the optimal conditions for expressing and purifying recombinant OsCYB5-2?

Successful expression and purification of functional recombinant OsCYB5-2 requires careful consideration of expression systems and purification strategies:

  • Expression System Selection:

    • E. coli: The BL21(DE3) strain is preferred for cytochrome b5 expression due to its deficiency in proteases. Co-expression with heme biosynthesis genes may enhance heme incorporation.

    • Yeast: Pichia pastoris offers advantages for membrane proteins, providing eukaryotic folding machinery and post-translational modifications.

    • Insect cells: The baculovirus expression system is suitable for obtaining larger quantities of properly folded protein with native-like post-translational modifications.

  • Expression Construct Design:

    • Include an N-terminal affinity tag (His6 or GST) for purification

    • For full-length protein, retain the C-terminal transmembrane domain

    • For soluble variant, truncate the C-terminal hydrophobic region (similar to viral cytochrome b5 proteins)

    • Incorporate a precision protease cleavage site between the tag and the protein

  • Expression Conditions Optimization:

    • Induce at lower temperatures (16-20°C) to enhance proper folding

    • Add δ-aminolevulinic acid (0.5 mM) as heme precursor to the growth medium

    • Use TB or 2xYT media for higher protein yields

    • Optimize induction timing and inducer concentration through small-scale trials

  • Purification Protocol:

    • For membrane-bound variants:
      a. Solubilize membranes with mild detergents (DDM or CHAPS)
      b. Perform affinity chromatography with immobilized metal affinity columns
      c. Apply size exclusion chromatography for final purification

    • For soluble variants:
      a. Lyse cells in buffer containing 50 mM phosphate pH 7.4, 300 mM NaCl
      b. Apply to nickel affinity column
      c. Wash with increasing imidazole concentrations
      d. Elute with 250 mM imidazole
      e. Remove tag via protease cleavage
      f. Perform ion exchange and size exclusion chromatography

  • Quality Control Assessment:

    • Verify purity by SDS-PAGE (expected molecular weight ~15 kDa)

    • Confirm heme incorporation through UV-visible spectroscopy (characteristic Soret band)

    • Assess protein folding via circular dichroism

    • Verify functionality through electron transfer assays

Optimized protocols typically yield 5-10 mg of purified protein per liter of culture, with >95% purity and appropriate heme incorporation for functional studies.

How can CRISPR-Cas9 be used to generate and characterize OsCYB5-2 knockout rice lines?

CRISPR-Cas9 technology offers a powerful approach for generating precise genetic modifications in rice to study OsCYB5-2 function:

  • Guide RNA Design:

    • Target exonic regions, preferably early in the coding sequence

    • Select targets with minimal off-target potential using tools like CRISPR-P or CRISPOR

    • Design 2-3 different sgRNAs to increase knockout efficiency

    • For Os05g0108800 (LOC_Os05g01820), target conserved regions encoding heme-binding domains

  • Vector Construction:

    • Clone sgRNAs into rice-optimized CRISPR-Cas9 vectors (e.g., pRGEB32)

    • Include appropriate selectable markers (hygromycin resistance)

    • Verify constructs by sequencing

  • Rice Transformation:

    • Transform rice calli using Agrobacterium-mediated transformation

    • Use japonica varieties (e.g., Nipponbare) for higher transformation efficiency

    • Select transformed calli on hygromycin-containing media

    • Regenerate plants through standard tissue culture protocols

  • Screening and Genotyping:

    • Extract genomic DNA from regenerated plantlets

    • Amplify the target region using PCR

    • Identify mutations through:
      a. T7 Endonuclease I assay for initial screening
      b. Sanger sequencing to characterize specific mutations
      c. Next-generation sequencing for comprehensive mutation analysis

  • Phenotypic Characterization:

    • Assess growth parameters under normal and salt stress conditions

    • Measure potassium content in different tissues

    • Perform 86Rb+ uptake experiments to quantify K+ transport

    • Analyze gene expression changes using RNA-seq

    • Evaluate interaction with OsHAK21 using co-immunoprecipitation

  • Complementation Studies:

    • Re-introduce wild-type OsCYB5-2 into knockout lines

    • Create point mutations in conserved histidine residues to disrupt heme binding

    • Test whether OsCYB5-2 from other species can functionally replace the rice protein

  • Field Evaluation:

    • Conduct controlled field trials under varying salt stress conditions

    • Measure agronomic traits including yield components

    • Assess plant-water relations and photosynthetic parameters

This comprehensive approach will provide definitive evidence regarding the role of OsCYB5-2 in rice salt tolerance and potassium homeostasis, while generating valuable genetic resources for crop improvement programs.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.