Recombinant Oryza sativa subsp. japonica Cytochrome b6-f complex iron-sulfur subunit, chloroplastic (petC)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and the protein's inherent stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
petC; Os07g0556200; LOC_Os07g37030; OsJ_06631; OSJNBa0058I18.25; Cytochrome b6-f complex iron-sulfur subunit, chloroplastic; Plastohydroquinone:plastocyanin oxidoreductase iron-sulfur protein; Rieske iron-sulfur protein; ISP; RISP
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
47-225
Protein Length
Full Length of Mature Protein
Species
Oryza sativa subsp. japonica (Rice)
Target Names
petC
Target Protein Sequence
AASSIPADRVPDMGKRQLMNLLLLGAISLPTVGMLVPYGAFFIPAGSGNAGGGQVAKDKL GNDVLAEEWLKTHGPNDRTLTQGLKGDPTYLVVEADKTLATYGINAVCTHLGCVVPWNAA ENKFICPCHGSQYNNQGRVVRGPAPLSLALVHADVDDGKVLFVPWVETDFRTGDNPWWA
Uniprot No.

Target Background

Function
A component of the cytochrome b6-f complex, mediating electron transfer between Photosystem II (PSII) and Photosystem I (PSI), cyclic electron flow around PSI, and state transitions.
Database Links

KEGG: osa:4343570

STRING: 39947.LOC_Os07g37030.1

UniGene: Os.2248

Subcellular Location
Plastid, chloroplast thylakoid membrane; Single-pass membrane protein.

Q&A

What is the structural and functional role of Cytochrome b6-f complex iron-sulfur subunit in rice photosynthesis?

The Cytochrome b6-f complex iron-sulfur subunit, encoded by the petC gene, is one of the large subunits of the cytochrome b6-f complex in rice chloroplasts. This protein functions as a high-potential [2Fe-2S] protein (Rieske iron-sulfur protein) and plays a critical role in mediating electron transfer between photosystem II (PSII) and photosystem I (PSI) during photosynthesis . The protein is specifically localized in the chloroplast thylakoid membrane where it contributes to the generation of a proton motive force via the Q-cycle . This electrochemical process couples electron transfer with proton translocation to generate a transmembrane electrochemical H+ gradient across the thylakoid membrane, which is essential for ATP synthesis .

The mature Cytochrome b6-f complex iron-sulfur subunit in Oryza sativa subsp. japonica has a molecular weight of approximately 21.52 kD, similar to its counterparts in other photosynthetic organisms such as Chlamydomonas reinhardtii . The protein contains a characteristic Rieske domain with the [2Fe-2S] cluster that is essential for its electron transfer function.

How does the structure of petC differ between indica and japonica rice subspecies?

Comparative genomic analyses between Oryza sativa subspecies indica (represented by varieties such as 93-11, Minghui 63, and Zhenshan 97) and japonica (represented by Nipponbare) have revealed significant genetic variations, including those that may affect the petC gene .

A proteomic study specifically examining differences between indica (93-11) and japonica (Nipponbare) rice varieties identified 47 proteins that differed significantly between these subspecies . While specific differences in petC were not detailed in these search results, the study established that certain proteins were expressed only in one subspecies - seven proteins were exclusive to Nipponbare (japonica) and one protein was specific to 93-11 (indica) .

The comparative analysis methodology employed whole genome sequencing, BAC-based physical maps, and proteomic tools including two-dimensional electrophoresis and mass spectrometry to identify these subspecies-specific differences . These differences may affect various aspects of rice development and metabolism, potentially including photosynthetic efficiency through proteins like petC.

What are the optimal methods for expressing and purifying recombinant Cytochrome b6-f complex iron-sulfur subunit from rice?

For the expression and purification of the recombinant Cytochrome b6-f complex iron-sulfur subunit from rice, several methodological approaches can be utilized:

Expression Systems Options:

This seed-based expression system offers several advantages including long-term stability during storage at room temperature, the ability to stockpile without synchronizing production with demand, and facilitated downstream purification .

Purification Strategy:
For purification of the recombinant protein, the following methods are recommended:

  • Targeting the protein to oil bodies through oleosin fusion enables easy separation of the protein from other cellular components

  • Addition of an affinity tag (such as His-tag) can facilitate purification using affinity chromatography

  • The use of appropriate protease cleavage sites to separate the protein of interest from its fusion partner

The search results indicate that this approach has yielded up to 20 μg of peptide per gram of rice grain when using the oleosin fusion technology .

What analytical techniques are most effective for assessing the functional activity of the Cytochrome b6-f complex iron-sulfur subunit?

To assess the functional activity of the Cytochrome b6-f complex iron-sulfur subunit in rice, multiple complementary analytical approaches should be employed:

Spectroscopic Methods:

Biochemical Assays:

  • Electron Transport Rate Measurements: Isolated thylakoid membranes can be used to measure electron transport rates through the cytochrome b6-f complex using artificial electron donors and acceptors.

  • Redox State Analysis: The redox state of the [2Fe-2S] cluster in the Rieske protein can be assessed using electron paramagnetic resonance (EPR) spectroscopy.

Structural Analysis:

  • Ultrastructural Examination: Chloroplast ultrastructure can be examined using transmission electron microscopy (TEM) to assess thylakoid membrane organization and potential structural alterations .

  • Protein-Protein Interaction Studies: Co-immunoprecipitation or yeast two-hybrid assays can be used to study interactions between the iron-sulfur subunit and other components of the cytochrome b6-f complex.

Functional Complementation:
The functionality of recombinant or mutant versions of petC can be assessed by complementation studies in petC-deficient mutants, similar to the approach used in studies like those on the OsiWAK1 protein in rice .

How is petC gene expression regulated during different developmental stages and stress conditions in rice?

The regulation of petC gene expression in rice during development and under stress conditions involves complex mechanisms that require specific experimental approaches to elucidate. Based on methodologies described in the search results, the following approaches are recommended:

Developmental Regulation Analysis:

  • Quantitative Real-Time PCR (qRT-PCR): This technique can be used to quantify petC transcript levels across different developmental stages, as demonstrated in studies examining tissue-specific gene expression in rice . For rice petC expression analysis, RNA extraction should be performed using Trizol reagent, followed by cDNA synthesis and qRT-PCR using gene-specific primers. The ACTIN gene typically serves as an internal reference gene, and experiments should be conducted in triplicate .

  • RNA-Seq Analysis: High-throughput sequencing can provide genome-wide expression profiles, allowing for the identification of co-expressed genes and potential regulatory networks involving petC during rice development.

Stress Response Studies:
The search results suggest methodologies for studying gene expression under stress conditions, such as those employed in zinc toxicity studies in rice . These approaches can be adapted to study petC regulation under various stresses:

  • Controlled Stress Experiments: Rice plants can be grown hydroponically with controlled stress treatments (e.g., nutrient deficiency, heavy metal toxicity, drought, high light) followed by petC expression analysis using qRT-PCR or RNA-Seq.

  • Comparative Analysis Between Varieties: Different rice varieties (e.g., indica vs. japonica) may exhibit different regulatory responses of petC under stress. Comparative expression studies, similar to those performed for other genes , can reveal subspecies-specific regulatory mechanisms.

  • Pathway Analysis: Photosynthesis pathway analysis through high-throughput sequencing, as demonstrated in a study examining the effects of zinc stress on rice photosynthesis , can reveal how petC regulation is integrated within the broader photosynthetic apparatus response to stress conditions.

What epigenetic factors influence petC expression in different rice subspecies?

Epigenetic regulation of petC expression in rice subspecies may involve several mechanisms that can be investigated using the following methodological approaches:

DNA Methylation Analysis:

  • Bisulfite Sequencing: This technique can be used to identify DNA methylation patterns in the petC promoter and gene body regions across different rice subspecies. Analysis of methylation differences between indica and japonica varieties may reveal subspecies-specific epigenetic regulation.

  • Methylation-Sensitive PCR: This approach can be used for targeted analysis of specific CpG islands within regulatory regions of the petC gene.

Histone Modification Studies:

  • Chromatin Immunoprecipitation (ChIP) Assays: ChIP followed by qPCR or sequencing (ChIP-seq) can identify histone modifications associated with the petC locus in different rice subspecies under various environmental conditions.

Small RNA Regulation:

  • Small RNA Sequencing: This approach can identify potential small RNAs that target petC transcripts for degradation or translational repression.

Integration with Genomic Diversity Data:
The search results indicate substantial genomic diversity between indica and japonica rice varieties . To relate this to potential epigenetic regulation of petC:

  • Comparative Genomic Analysis: Utilizing the BAC-based physical maps and genome sequences available for different rice varieties to identify sequence variations in petC regulatory regions that might affect epigenetic modifications.

  • Association Studies: Correlating identified epigenetic marks with phenotypic differences in photosynthetic efficiency between rice subspecies.

What phenotypic effects are observed in petC knockout or knockdown rice lines?

Based on the search results and methodologies employed in similar studies, the phenotypic effects of petC knockout or knockdown in rice can be comprehensively assessed using the following approaches:

Growth and Development Assessment:

Photosynthetic Performance:

  • Chlorophyll Content and Composition: Measurement of chlorophyll (a+b) content and the ratio of chlorophyll a/b, as demonstrated in studies examining photosynthetic responses in rice . A typical methodology would involve spectrophotometric analysis of acetone-extracted pigments.

  • Photosynthetic Parameters: Analysis of chlorophyll fluorescence parameters (Fv/F0, Fv/Fm), net photosynthetic rate (Pn), transpiration rate (Tr), stomatal conductance (Gs), and intercellular CO2 concentration (Ci) . These measurements would provide insights into how petC disruption affects photosynthetic electron transport efficiency.

Ultrastructural Analysis:

  • Transmission Electron Microscopy (TEM): Examination of chloroplast ultrastructure to detect potential alterations in thylakoid membrane organization, similar to methods used in other rice photosynthesis studies . Specific attention should be paid to the structure of the cytochrome b6-f complex and organization of photosynthetic complexes.

Molecular Compensation:

  • Transcriptome Analysis: RNA-Seq to identify genes with altered expression in petC mutants, potentially revealing compensatory mechanisms or downstream effects.

  • Proteome Analysis: Two-dimensional electrophoresis and mass spectrometry to identify changes in protein abundance and post-translational modifications in response to petC disruption.

Based on studies of other photosynthetic components in plants, it can be anticipated that petC knockout might result in severe growth retardation, altered chloroplast development, reduced photosynthetic efficiency, and potentially lethality, while knockdown lines might exhibit less severe but significant impairments in growth and photosynthesis.

How do environmental conditions affect the phenotype of petC mutants compared to wild-type rice?

The environmental responses of petC mutants compared to wild-type rice can be systematically investigated using controlled condition experiments:

Light Response Studies:

  • Light Intensity Gradients: Growing plants under different light intensities (low, medium, high) to evaluate how petC mutations affect acclimation to varying light conditions. Measurements should include photosynthetic parameters, growth metrics, and biochemical composition.

  • Light Quality Experiments: Exposure to different light spectra (red, blue, far-red) to assess wavelength-specific responses of the mutants, which may reveal functional aspects of the cytochrome b6-f complex in different light harvesting pathways.

Temperature Sensitivity:

  • Temperature Gradient Analysis: Comparative growth and photosynthetic performance of wild-type and mutant plants across a temperature range (cold, optimal, heat stress) to determine if petC mutations alter temperature sensitivity of the photosynthetic apparatus.

Nutrient Availability Effects:

  • Nutrient Limitation Experiments: Evaluation of plant performance under limited availability of specific nutrients, particularly iron and sulfur which are essential for iron-sulfur cluster formation.

  • Heavy Metal Stress: Assessment of responses to heavy metals like zinc, using methodologies similar to those employed in studies of zinc effects on rice photosynthesis .

Water Availability:

  • Drought Stress Experiments: Comparison of drought responses between wild-type and petC mutant plants, with analysis of photosynthetic parameters, water use efficiency, and survival rates.

Oxidative Stress Tolerance:

  • ROS Generation and Scavenging: Measurement of reactive oxygen species production and antioxidant enzyme activities to determine if petC mutations affect redox homeostasis and oxidative stress tolerance.

Integrated Multi-Stress Analysis:

  • Combined Stress Treatments: Exposure to combinations of stresses to identify potential synergistic effects of environmental factors on petC mutant phenotypes.

Results from these experiments would provide insights into how the Cytochrome b6-f complex iron-sulfur subunit contributes to environmental adaptation in rice and how its dysfunction might limit plant responses to changing environmental conditions.

How has the petC gene and protein sequence evolved across different rice species and varieties?

The evolutionary analysis of the petC gene and protein sequence across rice species and varieties can be conducted using the following methodological approaches:

Sequence Comparison and Phylogenetic Analysis:

  • Multiple Sequence Alignment: Alignment of petC nucleotide and amino acid sequences from different rice species (Oryza sativa subspecies, wild rice species) to identify conserved and divergent regions. Tools such as MUSCLE or CLUSTALW can be used for this purpose.

  • Phylogenetic Tree Construction: Using methods such as Maximum Likelihood or Bayesian inference to construct evolutionary trees based on petC sequences, revealing the evolutionary relationships and divergence patterns.

Comparative Genomic Analysis:
The search results indicate that extensive genomic diversity studies have been conducted between indica and japonica rice varieties . These approaches can be applied specifically to petC analysis:

  • SNP and Indel Identification: Between the bacterial artificial chromosome (BAC) end sequences of different rice varieties, a total of 71,383 SNPs, 1,767 multiple nucleotide polymorphisms, 6,340 insertions, and 9,137 deletions were identified . Similar methodologies can be used to analyze petC sequence variations.

  • Structural Variation Analysis: Examination of larger-scale genomic rearrangements affecting the petC locus, using approaches similar to those used in comparative physical map analyses between rice subspecies .

  • Selective Pressure Analysis: Calculation of Ka/Ks ratios (non-synonymous to synonymous substitution rates) to determine if petC has been under purifying, neutral, or positive selection during rice evolution.

Functional Domain Conservation:

  • Domain Structure Analysis: Comparison of functional domains within the petC protein across rice varieties, with particular attention to the Rieske iron-sulfur domain and transmembrane regions.

  • 3D Structure Prediction and Comparison: Homology modeling of petC protein structures from different rice varieties to identify potential structural variations affecting function.

Integration with Genomic Resources:
The search results mention the OMAP (Oryza Map Alignment Project) resource, which includes BAC libraries and physical maps for 17 of 23 Oryza species representing all 10 genome types . These resources can be utilized to:

  • Cross-Species Comparison: Extend the petC evolutionary analysis beyond cultivated rice to wild Oryza species.

  • Integrative Analysis: Combine petC sequence evolution with broader genomic evolution patterns in the Oryza genus.

How does the function of Cytochrome b6-f complex iron-sulfur subunit in rice compare to its homologs in other crop species?

A comparative functional analysis of the Cytochrome b6-f complex iron-sulfur subunit across crop species requires integrative approaches:

Comparative Biochemical Characterization:

  • Enzyme Kinetics Analysis: Comparison of electron transfer kinetics mediated by petC from different species under standardized conditions.

  • Spectroscopic Characterization: Analysis of the redox properties of the [2Fe-2S] cluster in petC from different species using techniques such as EPR or UV-visible spectroscopy.

Structural Comparison:

  • Sequence and Structure Alignment: Comparison of protein sequences and predicted or resolved structures of petC homologs from various crop species to identify conserved features and species-specific adaptations.

  • Molecular Dynamics Simulations: In silico analysis of potential functional differences based on structural variations.

Cross-Species Complementation Studies:

  • Heterologous Expression and Complementation: Expression of petC genes from different crop species in a rice petC mutant background to assess functional conservation through phenotypic rescue.

  • Domain Swapping Experiments: Creation of chimeric petC proteins containing domains from different species to identify functionally divergent regions.

Evolutionary Context Analysis:

  • Correlation with Photosynthetic Efficiency: Analysis of whether petC sequence variations correlate with differences in photosynthetic efficiency or environmental adaptation across crop species.

  • Integration with Physiological Traits: Examination of relationships between petC sequence/structure and physiological traits such as photosynthetic capacity, stress tolerance, and growth patterns across species.

These comparative approaches would provide insights into how evolutionary adaptations in the petC protein might contribute to species-specific photosynthetic capabilities and environmental adaptations in different crop plants.

How can genome editing techniques be optimized for targeted modifications of the petC gene in rice?

Optimizing genome editing techniques for targeted modifications of the petC gene in rice requires consideration of several methodological aspects:

CRISPR/Cas9 System Optimization:

  • Guide RNA (gRNA) Design: Multiple gRNAs targeting different regions of the petC gene should be designed and evaluated for efficiency and specificity. Tools such as CRISPR-P or CHOPCHOP can assist in identifying optimal target sites with minimal off-target effects.

  • Cas9 Variant Selection: Considering the importance of precision when modifying essential photosynthetic genes, high-fidelity Cas9 variants (e.g., eSpCas9, SpCas9-HF1) may be preferred to minimize off-target effects.

  • Delivery Method Optimization: For rice transformation, both Agrobacterium-mediated transformation and biolistic methods can be employed. The search results indicate successful Agrobacterium tumefaciens-mediated transformation of embryogenic rice calli for generating transgenic plants .

Precise Editing Strategies:

  • Base Editing Approach: For single nucleotide modifications in petC, cytosine or adenine base editors may provide higher precision without introducing double-strand breaks.

  • Prime Editing: This technique allows for more precise editing without requiring double-strand breaks and could be advantageous for introducing specific modifications in the petC gene.

Tissue-Specific or Inducible Editing:
Given the essential nature of petC for photosynthesis, complete knockout might be lethal. Therefore:

  • Inducible CRISPR Systems: Utilizing chemically inducible or heat-shock inducible promoters to control Cas9 expression, allowing temporal control of editing.

  • Tissue-Specific Promoters: Using photosynthetic tissue-specific promoters for controlled spatial expression of the CRISPR components.

Selection and Screening Strategies:

  • Marker-Free Selection: Implementing strategies to generate marker-free edited plants, such as co-segregation approaches or transient expression of selectable markers.

  • High-Throughput Screening: Developing efficient screening methods using targeted sequencing approaches or phenotypic screening based on chlorophyll fluorescence parameters to identify successfully edited plants.

Homology-Directed Repair (HDR) Enhancement:
For precise gene replacement or insertion:

  • DNA Repair Pathway Modulation: Transient inhibition of non-homologous end joining (NHEJ) to favor HDR.

  • Optimized Donor Template Design: Incorporation of efficient homology arms flanking the desired modification.

These methodologies would enable researchers to generate precise modifications in the petC gene, creating valuable resources for functional studies and potentially for improving photosynthetic efficiency in rice.

What potential applications exist for engineering enhanced photosynthetic efficiency through modifications of the Cytochrome b6-f complex in rice?

Engineering the Cytochrome b6-f complex in rice through petC modifications presents several potential applications for enhancing photosynthetic efficiency:

Electron Transport Rate Enhancement:

  • Catalytic Efficiency Improvement: Structure-guided modifications of the Rieske iron-sulfur domain to potentially enhance electron transfer rates between PSII and PSI.

  • Redox Potential Optimization: Targeted mutations to adjust the redox potential of the [2Fe-2S] cluster for improved electron flow under specific environmental conditions.

Environmental Stress Adaptation:

  • Temperature Stability Enhancement: Introduction of thermostable variants of petC from extremophile organisms or rational design of mutations that increase protein stability under temperature fluctuations.

  • Oxidative Stress Tolerance: Modifications to reduce susceptibility to ROS damage during high light or drought stress conditions.

Photosynthetic Efficiency Improvement:

  • Cytochrome b6-f Complex Abundance Modulation: Overexpression of petC in coordination with other complex components to potentially increase the concentration of functional complexes in thylakoid membranes.

  • Q-cycle Optimization: Strategic modifications to enhance the efficiency of the Q-cycle, potentially improving proton gradient formation and subsequent ATP synthesis.

Research and Biotechnological Applications:

  • Reporter Systems Development: Creation of tagged petC variants for in vivo monitoring of protein dynamics and complex assembly.

  • Synthetic Biology Applications: Integration of modified cytochrome b6-f complexes into synthetic electron transport systems for bioenergy applications.

Methodological Considerations for Engineering Approaches:
When pursuing these applications, researchers should implement:

These engineering approaches have the potential to contribute to the development of rice varieties with enhanced photosynthetic efficiency, potentially leading to improved yield and stress resilience in changing climate conditions.

What are the most common technical challenges in studying recombinant Cytochrome b6-f complex iron-sulfur subunit and how can they be overcome?

Research on the recombinant Cytochrome b6-f complex iron-sulfur subunit presents several technical challenges that can be addressed through specific methodological approaches:

Expression and Stability Challenges:

  • Protein Instability: The iron-sulfur subunit may exhibit instability when expressed recombinantly due to its complex structure and iron-sulfur cluster.

    • Solution: Use of the oleosin fusion technology, as demonstrated in the search results for other proteins . This approach can provide stability to the recombinant protein and facilitate its accumulation in rice seeds at levels up to 20 μg per gram of grain .

  • Proper Folding and Metal Cluster Assembly: Formation of the [2Fe-2S] cluster is essential for functionality but challenging to achieve in heterologous systems.

    • Solution: Co-expression with iron-sulfur cluster assembly proteins, expression in chloroplast-containing systems, or addition of iron and sulfur supplements to expression media.

Purification Difficulties:

  • Membrane Protein Solubilization: As a thylakoid membrane protein, the iron-sulfur subunit requires careful solubilization.

    • Solution: Optimization of detergent type and concentration (e.g., n-dodecyl-β-D-maltoside, digitonin) for efficient extraction while maintaining protein structure and function.

  • Maintaining Complex Integrity: Preserving interactions within the cytochrome b6-f complex during purification.

    • Solution: Mild solubilization conditions, blue native PAGE for complex separation, or co-purification approaches targeting multiple complex components simultaneously.

Functional Assay Limitations:

  • In vitro Activity Measurement: Establishing reliable activity assays for the isolated protein or complex.

    • Solution: Development of reconstituted systems with artificial electron donors and acceptors, or proteoliposome-based assays simulating the native membrane environment.

Structural Analysis Challenges:

  • Crystallization Difficulties: Membrane proteins are notoriously difficult to crystallize for structural studies.

    • Solution: Lipidic cubic phase crystallization, detergent screening, or cryo-electron microscopy as an alternative approach for structural determination.

Rice-Specific Expression Strategies:

The search results indicate successful strategies for protein expression in rice seeds , which can be adapted for petC:

  • Targeting Strategy Optimization: The search results show that targeting proteins to oil bodies through oleosin fusion is more effective than targeting to protein bodies for certain proteins in rice seeds .

    • Solution: Design of chimeric genes fusing the petC coding sequence to Oleosin18, under the control of the Ole18 promoter, for specific accumulation in the embryo and aleurone layer of rice seeds .

  • Tissue-Specific Expression: The search results demonstrate successful tissue-specific expression using appropriate promoters .

    • Solution: Selection of promoters for desired expression patterns, such as the Ole18 promoter for embryo-specific expression or photosynthetic tissue-specific promoters for expression in leaf chloroplasts.

These methodological solutions provide pathways to overcome the technical challenges associated with studying the recombinant Cytochrome b6-f complex iron-sulfur subunit in rice.

What statistical approaches are most appropriate for analyzing data from experiments involving petC gene expression or protein function?

Appropriate statistical analysis of data from petC experiments requires consideration of experimental design and data characteristics:

Expression Studies Analysis:

  • Quantitative PCR Data Analysis:

    • Normalization Approaches: The search results indicate that the ACTIN gene is commonly used as an internal reference gene for qRT-PCR in rice . Multiple reference genes should be validated for stability across experimental conditions.

    • Statistical Methods: ANOVA with post-hoc tests (e.g., Tukey's test) for comparing expression levels across multiple conditions or genotypes . The search results demonstrate this approach for analyzing plant physiological data in rice .

    • Fold Change Calculation: The 2^(-ΔΔCt) method with appropriate error propagation.

  • RNA-Seq Data Analysis:

    • Normalization Methods: TPM (Transcripts Per Million) or FPKM (Fragments Per Kilobase Million) for within-sample normalization, followed by between-sample normalization methods such as TMM (Trimmed Mean of M-values).

    • Differential Expression Analysis: DESeq2 or edgeR for identifying statistically significant differences in petC expression across conditions.

    • Multiple Testing Correction: Benjamini-Hochberg procedure to control false discovery rate in genome-wide expression analyses.

Protein Function Studies:

  • Enzyme Kinetics Analysis:

    • Model Fitting: Non-linear regression for fitting enzyme kinetic models (e.g., Michaelis-Menten) to electron transfer rate data.

    • Parameter Comparison: Extra sum-of-squares F test for comparing kinetic parameters between wild-type and modified petC proteins.

  • Chlorophyll Fluorescence Data:

    • Repeated Measures ANOVA: For time-series fluorescence measurements.

    • Mixed-Effects Models: When accounting for both fixed effects (e.g., genotype, treatment) and random effects (e.g., individual plant variation).

Photosynthetic Parameter Analysis:

The search results describe analysis of photosynthetic parameters in rice , which is relevant to petC function:

  • Two-Way ANOVA: For analyzing the effects of multiple factors (e.g., genotype and treatment) on photosynthetic parameters like Fv/F0, Fv/Fm, Pn, Tr, Gs, and Ci .

    • Post-hoc Tests: When ANOVA indicates significant differences, post-hoc tests such as Tukey's HSD or Bonferroni correction should be applied .

  • Correlation Analysis: Pearson or Spearman correlation to assess relationships between petC expression/activity and photosynthetic parameters.

Multivariate Approaches:

  • Principal Component Analysis (PCA): The search results demonstrate the use of PCA to simplify complex datasets, such as reducing 18 rice quality-related traits to 8 independent principal components . This approach could be valuable for analyzing multiple parameters related to petC function and its effects on photosynthesis.

  • Hierarchical Clustering: For identifying patterns in expression data or grouping physiological responses.

  • Structural Equation Modeling (SEM): The search results mention the use of SEM to reveal how environmental factors indirectly influence gene expression by altering soil properties and enzyme activities . This approach could be valuable for modeling complex relationships between petC, photosynthetic parameters, and environmental variables.

How can systems biology approaches integrate petC function with broader photosynthetic and metabolic networks in rice?

Systems biology approaches offer powerful frameworks for integrating petC function within the broader context of rice photosynthesis and metabolism:

Multi-Omics Integration:

  • Integrated Transcriptomics, Proteomics, and Metabolomics:

    • Methodology: Generation of datasets across multiple organizational levels (gene expression, protein abundance, metabolite profiles) from the same samples under identical conditions.

    • Statistical Integration: Correlation networks, canonical correlation analysis, or partial least squares regression to identify relationships between petC expression/activity and broader cellular processes.

    • Visualization Tools: Cytoscape or similar platforms for network visualization and analysis.

  • Temporal Multi-Omics:

    • Approach: Time-series sampling to capture dynamic responses and regulatory relationships involving petC following perturbations (e.g., light fluctuations, developmental transitions).

Network Biology Approaches:

  • Co-Expression Network Analysis:

    • Methodology: Construction of gene co-expression networks using approaches such as WGCNA (Weighted Gene Co-expression Network Analysis) to identify modules of genes that share expression patterns with petC.

    • Hub Gene Identification: Determination of whether petC acts as a hub gene within photosynthetic networks, potentially influencing multiple downstream processes.

  • Protein-Protein Interaction Networks:

    • Experimental Approaches: Yeast two-hybrid, co-immunoprecipitation coupled with mass spectrometry, or proximity labeling techniques to identify interaction partners of the petC protein.

    • Network Expansion: Integration with publicly available protein interaction databases to place petC-specific interactions within the broader cellular interactome.

Genome-Scale Metabolic Modeling:

  • Flux Balance Analysis (FBA):

    • Model Development: Incorporation of petC-mediated reactions into genome-scale metabolic models of rice.

    • In silico Perturbation Analysis: Simulation of petC modifications to predict effects on photosynthetic efficiency and metabolic fluxes.

    • Constraint-Based Modeling: Integration of experimental data as constraints to refine model predictions.

Phenomics Integration:

  • High-Throughput Phenotyping:

    • Data Collection: Automated image-based phenotyping of wild-type and petC-modified plants under various environmental conditions.

    • Multi-Trait Analysis: Integration of growth, photosynthetic, and stress response phenotypes with molecular data.

Epistasis Analysis:

The search results describe an approach called RIL-StEp (recombinant inbred lines stepwise epistasis detection) for detecting epistatic gene interactions in rice . This or similar approaches could be used to:

  • Identify Genetic Interactions:

    • Methodology: Analysis of how petC allelic variations interact with other genetic loci to influence photosynthetic efficiency.

    • Model Development: Construction of statistical models that account for both additive effects and epistatic interactions involving petC.

Environmental Response Integration:

The search results discuss studies of rice responses to environmental factors such as silicon supplementation and zinc stress . Similar approaches could be applied to understand petC function in environmental contexts:

  • Multi-Factor Experimental Designs:

    • Approach: Factorial designs testing combinations of genetic variations (wild-type vs. modified petC) and environmental conditions.

    • Analysis: ANOVA or more complex statistical models to dissect main effects and interactions.

These systems biology approaches would provide a comprehensive understanding of how petC functions within the complex network of photosynthetic and metabolic processes in rice, potentially revealing new targets for improving photosynthetic efficiency.

What bioinformatic tools and databases are most valuable for analyzing the evolutionary and functional aspects of petC across plant species?

A comprehensive bioinformatic analysis of petC evolution and function requires utilization of diverse tools and databases:

Sequence Analysis Tools:

  • Multiple Sequence Alignment Software:

    • MUSCLE, MAFFT, or T-Coffee: For aligning petC sequences across species with high sensitivity.

    • PRALINE or PROMALS3D: For alignments incorporating structural information about the protein.

  • Phylogenetic Analysis Tools:

    • RAxML or IQ-TREE: For maximum likelihood tree construction.

    • MrBayes or BEAST: For Bayesian phylogenetic inference, particularly valuable for estimating divergence times of petC across lineages.

    • PAML: For detection of positive selection and evolutionary rate analysis.

Structural Bioinformatics Resources:

  • Protein Structure Prediction:

    • AlphaFold2 or RoseTTAFold: For generating high-confidence structural models of petC from different species.

    • PyMOL or UCSF Chimera: For structural visualization and comparative analysis.

  • Molecular Dynamics Simulation:

    • GROMACS or NAMD: For simulating dynamics of petC variants to assess functional implications of sequence differences.

Functional Annotation Tools:

  • Domain Prediction and Analysis:

    • InterPro or Pfam: For identifying conserved domains within petC sequences.

    • ConSurf: For mapping evolutionary conservation onto protein structures to identify functionally important regions.

  • Post-Translational Modification Prediction:

    • NetPhos or GPS: For phosphorylation site prediction.

    • NetNGlyc or NetOGlyc: For glycosylation site prediction.

Plant-Specific Databases:

  • Genome Databases:

    • Phytozome: Comprehensive plant genomics resource with tools for comparative analysis.

    • Gramene: Resource for comparative genomics in plants, with particular strength in grasses including rice.

    • Rice Genome Annotation Project: Detailed annotation of the rice genome, including petC.

  • Expression Databases:

    • Rice Expression Database: For tissue-specific and condition-specific expression data.

    • Bio-Analytic Resource for Plant Biology (BAR): For expression visualization across multiple plant species.

Rice-Specific Resources Mentioned in Search Results:

  • OMAP (Oryza Map Alignment Project): Contains BAC libraries and physical maps for 17 of 23 Oryza species representing all 10 genome types . This resource is valuable for studying petC evolution across Oryza species.

  • GRAMENE: Mentioned in the search results as a source of QTL and molecular markers . This database integrates genetic, genomic, and comparative genomics data for plant research.

  • Rice Subspecies Genomic Resources: The search results mention genomic resources for indica varieties (MH63, ZS97, 93-11) and japonica (Nipponbare) , which would be valuable for comparing petC between rice subspecies.

Pathway and Network Databases:

  • MetaCyc: Contains information about the cytochrome b6f complex and its components, as shown in the search results .

  • Kyoto Encyclopedia of Genes and Genomes (KEGG): For pathway mapping and analysis of petC in the context of photosynthesis.

  • STRING or BioGRID: For protein-protein interaction network analysis.

Integrated Analysis Platforms:

  • Galaxy: Web-based platform for accessible bioinformatic analysis, allowing integration of multiple tools in customized workflows.

  • Cytoscape: For visualization and analysis of molecular interaction networks, potentially revealing functional relationships involving petC.

Utilizing these bioinformatic resources in combination would enable comprehensive analysis of petC evolution and function across plant species, providing insights into both conservation and divergence of this important photosynthetic component.

What interdisciplinary research areas could benefit from studies of the Cytochrome b6-f complex iron-sulfur subunit in rice?

Research on the Cytochrome b6-f complex iron-sulfur subunit in rice offers opportunities for collaboration across multiple disciplines:

Agricultural Sciences and Plant Breeding:

  • Crop Improvement Programs: Integration of petC variants into breeding programs aimed at improving photosynthetic efficiency and yield potential in rice.

  • Stress Tolerance Enhancement: Collaboration with abiotic stress researchers to explore how petC modifications might improve resilience to environmental challenges such as drought, high temperature, or light fluctuations.

Biochemistry and Structural Biology:

  • Protein Engineering: Partnerships with protein engineers to design optimized versions of petC with enhanced stability or electron transport capabilities.

  • Structural Biology Initiatives: Collaboration with structural biologists to determine high-resolution structures of the rice cytochrome b6-f complex under different conditions.

Synthetic Biology and Metabolic Engineering:

  • Artificial Photosynthetic Systems: Development of simplified photosynthetic units incorporating optimized petC components for bioenergy applications.

  • Metabolic Flux Optimization: Engineering of photosynthetic electron transport to enhance carbon fixation or redirect electron flow toward valuable products.

Computational Biology and Bioinformatics:

  • Evolutionary Genomics: Comparison of petC across rice varieties and related species to understand evolutionary adaptation of photosynthesis, similar to comparative genomic analyses described in the search results .

  • Systems Biology Modeling: Development of comprehensive models integrating petC function within photosynthetic and metabolic networks.

Environmental Sciences:

  • Climate Change Adaptation: Research on how petC variants might enhance rice adaptation to changing environmental conditions.

  • Ecosystem Modeling: Integration of photosynthetic efficiency data into models predicting crop responses to future climate scenarios.

Biophysics and Spectroscopy:

  • Advanced Imaging Techniques: Application of cutting-edge spectroscopic methods to visualize electron transfer through the cytochrome b6-f complex in vivo.

  • Quantum Biology: Exploration of quantum effects in the electron transfer mechanisms mediated by the iron-sulfur cluster in petC.

Biotechnology and Protein Production:

  • Expression Platform Development: The search results demonstrate successful use of rice seeds as biofactories for recombinant proteins using oleosin fusion technology . Similar approaches could be developed for production of modified petC or other photosynthetic components.

  • Purification Method Optimization: Development of efficient protocols for isolating functional cytochrome b6-f complex from plants.

Nanobiotechnology:
The search results discuss the effects of nanoplastics on rice , suggesting potential collaborations to:

  • Study Nano-Material Interactions: Investigate how engineered nanomaterials interact with photosynthetic complexes including cytochrome b6-f.

  • Develop Nano-Sensors: Creation of biosensors using petC components to detect environmental contaminants affecting photosynthesis.

These interdisciplinary collaborations would not only advance our understanding of photosynthesis in rice but could also contribute to developing improved crop varieties and novel biotechnological applications.

How can researchers effectively collaborate across institutions to advance understanding of petC function in rice photosynthesis?

Effective multi-institutional collaboration on petC research can be structured using the following methodological framework:

Establishing Collaborative Infrastructure:

  • Shared Material Resource Development:

    • Germplasm Exchange: Development and distribution of a common set of rice lines with various petC modifications (knockouts, point mutations, tagged versions) accessible to all participating institutions.

    • Standardized Vectors and Constructs: Creation of a toolkit of expression vectors and regulatory elements optimized for petC studies in rice.

  • Data Sharing Platforms:

    • Centralized Repository: Establishment of a dedicated database for petC-related data, including sequences, expression profiles, phenotypic measurements, and experimental protocols.

    • Standardized Data Formats: Agreement on common formats and metadata standards to ensure interoperability of datasets generated by different research groups.

Coordinated Experimental Approaches:

  • Multi-Environment Testing Network:

    • Methodology: Coordinated cultivation and evaluation of identical rice lines across multiple locations representing different environmental conditions.

    • Implementation: Standardized protocols for growth conditions, phenotyping, and data collection to enable direct comparison of results across sites.

  • Specialized Technical Contributions:

    • Expertise Division: Allocation of specific technical aspects of petC research to institutions with specialized capabilities (e.g., structural studies, field trials, computational modeling).

    • Sample Sharing Protocols: Development of preservation and shipping methods to maintain sample integrity when sharing between institutions.

Analytical Integration Strategies:

  • Multi-Omics Coordination:

    • Complementary Omics Approaches: Coordination of different omics analyses (genomics, transcriptomics, proteomics, metabolomics) across institutions to build comprehensive datasets from shared materials.

    • Integrative Analysis Workshops: Regular collaborative sessions dedicated to integrating and interpreting multi-omics data from different sources.

  • Collaborative Modeling Efforts:

    • Model Refinement Cycles: Iterative development of predictive models with experimental validation distributed across participating institutions.

    • Virtual Working Groups: Regular online meetings focused on specific aspects of model development and refinement.

Knowledge Exchange Frameworks:

  • Regular Communication Structures:

    • Virtual Research Meetings: Scheduled online meetings with specific agendas focused on progress updates, problem-solving, and planning.

    • Annual In-Person Workshops: More extensive face-to-face meetings for deeper discussion, hands-on training, and strategic planning.

  • Training and Exchange Programs:

    • Researcher Mobility Program: Temporary exchanges of researchers between participating institutions to transfer specialized knowledge and techniques.

    • Joint Training Workshops: Collaborative training sessions on new methodologies relevant to petC research.

Funding and Sustainability Mechanisms:

  • Coordinated Grant Applications:

    • Complementary Proposals: Submission of interrelated but distinct funding proposals to diverse agencies to cover different aspects of the collaborative research.

    • International Funding Opportunities: Targeting multinational funding programs specifically designed for cross-border research collaborations.

  • Industry Partnerships:

    • Collaborative Research Agreements: Joint engagement with agricultural companies interested in photosynthesis improvement technologies.

    • Intellectual Property Frameworks: Clear pre-agreements on handling intellectual property arising from collaborative research.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.