Recombinant Oryza sativa subsp. japonica Cytochrome b6-f complex subunit 4 (petD)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Oryza sativa subsp. japonica Cytochrome b6-f Complex Subunit 4 (petD)

Recombinant Oryza sativa subsp. japonica Cytochrome b6-f complex subunit 4 (petD) is a protein derived from the cytochrome b6-f complex, which plays a crucial role in photosynthesis by facilitating electron transfer between photosystem II (PSII) and photosystem I (PSI) in chloroplasts. This protein is essential for cyclic electron flow around PSI and state transitions, processes that optimize photosynthetic efficiency under varying light conditions.

Function and Importance

The cytochrome b6-f complex, of which subunit 4 (petD) is a part, is integral to the photosynthetic electron transport chain. It mediates the transfer of electrons from plastoquinol to plastocyanin, generating a proton gradient across the thylakoid membrane that drives ATP synthesis. Subunit IV (petD) is known to be involved in proton translocation and electron transfer activities within the complex .

Structure and Characteristics

Subunit IV (petD) of the cytochrome b6-f complex is a single-pass membrane protein with a molecular mass of approximately 17 kDa . It is located in the thylakoid membrane of chloroplasts and is part of the larger cytochrome b6-f complex, which functions as a dimer . The recombinant version of this protein is often expressed in Escherichia coli and may be tagged with a His-tag for purification purposes .

Recombinant Production and Applications

Recombinant Oryza sativa subsp. japonica Cytochrome b6-f complex subunit 4 (petD) is produced using recombinant DNA technology, where the gene encoding the protein is inserted into a suitable expression vector and expressed in a host organism like E. coli. This recombinant protein is used in research studies to understand the structure-function relationships of the cytochrome b6-f complex and its role in photosynthesis. It is also available commercially for research purposes, with prices varying depending on the supplier .

Research Findings

Recent studies have highlighted the importance of interactions between subunits within the cytochrome b6-f complex. For example, salt bridge formation between cytochrome b6 and subunit IV is crucial for the assembly and stability of the complex . Additionally, subunit IV is sensitive to trypsin digestion, which affects the electron transfer activity of the complex .

Table 1: Characteristics of Recombinant Oryza sativa subsp. japonica Cytochrome b6-f Complex Subunit 4 (petD)

CharacteristicDescription
Molecular MassApproximately 17 kDa
Expression HostEscherichia coli
TagHis-tag for purification
FunctionElectron transfer and proton translocation in photosynthesis
LocationThylakoid membrane of chloroplasts

Table 2: Suppliers and Pricing

SupplierPrice
MyBioSource.com$1,435.00
Creative BiomartNot specified

Table 3: Key Interactions and Functions

SubunitInteraction/Function
Cytochrome b6 (PetB)Salt bridge formation with PetD essential for complex assembly
Subunit IV (PetD)Proton translocation and electron transfer

References MyBioSource.com. Recombinant Oryza sativa subsp. japonica Cytochrome b6-f complex subunit 4 (petD). PubMed. The catalytic role of subunit IV of the cytochrome b6-f complex. PubMed. The stromal side of the cytochrome b6f complex regulates state transitions. Creative Biomart. Recombinant Full Length Oryza Sativa Subsp. Japonica Cytochrome B6-F Complex Subunit 4(Petd) Protein, His-Tagged. UniProt/SWISS-PROT: CYF_ORYSJ. PMC. Structure of the Cytochrome b6f Complex: Quinone Analogue Binding Sites. CBM15. ELISA Recombinant Oryza sativa subsp. japonica Cytochrome b6-f complex subunit 4(petD). STRING interaction network. petC protein (Oryza sativa Japonica).

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and may serve as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and the protein's inherent stability.
Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
Tag type is determined during production. If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
petD; LOC_Osp1g00650; Nip099; Cytochrome b6-f complex subunit 4; 17 kDa polypeptide
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-160
Protein Length
full length protein
Species
Oryza sativa subsp. japonica (Rice)
Target Names
petD
Target Protein Sequence
MGVTKKPDLNDPVLRAKLAKGMGHNYYGEPAWPNDLLYIFPVVILGTIACNVGLAVLEPS MIGEPADPFATPLEILPEWYFFPVFQILRTVPNKLLGVLLMVSVPTGLLTVPFLENVNKF QNPFRRPVATTVFLIGTAVALWLGIGATLPIEKSLTLGLF
Uniprot No.

Target Background

Function

Component of the cytochrome b6-f complex. This complex mediates electron transfer between photosystem II (PSII) and photosystem I (PSI), cyclic electron flow around PSI, and state transitions.

Database Links
Protein Families
Cytochrome b family, PetD subfamily
Subcellular Location
Plastid, chloroplast thylakoid membrane; Multi-pass membrane protein.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.