Recombinant Oryza sativa subsp. japonica Cytochrome c oxidase subunit 2 (COX2)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and may serve as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms maintain stability for 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
If you require a specific tag, please inform us; we will prioritize its implementation.
Synonyms
COX2; COII; Cytochrome c oxidase subunit 2; Cytochrome c oxidase polypeptide II
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-260
Protein Length
full length protein
Species
Oryza sativa subsp. japonica (Rice)
Target Names
COX2
Target Protein Sequence
MILRSLECRFLTIALCDAAEPWQLGSQDAATPMMQGIIDLHHDIFFFLILILVFVSRMLV RALWHFNEQTNPIPQRIVHGTTIEIIRTIFPSVIPLFIAIPSFALLYSMDGVLVDPAITI KAIGHQWYRSYEYSDYNSSDEQSLTFDSYTIPEDDPELGQSRLLEVDNRVVVPAKTHLRM IVTPADVLHSWAVPSSGVKCDAVPGRSNLTSISVQREGVYYGQCSEICGTNHAFTPIVVE AVTLKDYADWVSNQLILQTN
Uniprot No.

Target Background

Function

Recombinant Oryza sativa subsp. japonica Cytochrome c oxidase subunit 2 (COX2) is a component of cytochrome c oxidase (Complex IV), the terminal enzyme in the mitochondrial electron transport chain (ETC). The ETC, comprised of Complexes I-IV, facilitates oxidative phosphorylation by transferring electrons from NADH and succinate to molecular oxygen. This process generates a proton gradient across the inner mitochondrial membrane, driving ATP synthesis. COX2 plays a crucial role in this process. Specifically, COX2's dinuclear copper A center (CuA) and heme A facilitate electron transfer from reduced cytochrome c in the intermembrane space to the binuclear center (BNC) in subunit 1. The BNC, consisting of heme a3 and copper B (CuB), catalyzes the reduction of molecular oxygen to water, utilizing four electrons from cytochrome c and four protons from the mitochondrial matrix.

Database Links
Protein Families
Cytochrome c oxidase subunit 2 family
Subcellular Location
Mitochondrion inner membrane; Multi-pass membrane protein.

Q&A

What is Oryza sativa COX2 and how does it differ from mammalian COX-2?

Oryza sativa COX2 (P04373) is the subunit 2 of cytochrome c oxidase, a component of the respiratory chain that catalyzes oxygen reduction to water in mitochondria. It functions as part of the electron transport chain in oxidative phosphorylation .

This protein should not be confused with mammalian cyclooxygenase-2 (COX-2), which is an enzyme involved in prostaglandin synthesis and inflammatory processes . The similarity in abbreviations creates confusion in literature, but these proteins have entirely different structures, functions, and evolutionary origins.

Key differences include:

FeatureOryza sativa COX2Mammalian COX-2
FunctionElectron transport in respirationProstaglandin synthesis
Cellular locationMitochondrial inner membraneEndoplasmic reticulum membrane
Size260 amino acids, ~30 kDa604 amino acids, ~70 kDa
InhibitorsCyanide, azideNSAIDs, coxibs
UniProt IDP04373Various (e.g., P35354 for human)

What are the optimal expression systems for producing recombinant Oryza sativa COX2?

Recombinant Oryza sativa COX2 has been successfully expressed in E. coli systems with N-terminal His-tags to facilitate purification . While bacterial expression is common for basic structural studies, researchers should consider the following systems based on research objectives:

Expression SystemAdvantagesDisadvantagesBest For
E. coliHigh yield, cost-effective, rapidLimited post-translational modificationsStructural studies, antibody production
Insect cells (Sf21)Better folding, some post-translational modificationsHigher cost, slower, lower yieldFunctional studies requiring proper folding
Plant-based systemsNative post-translational modificationsComplex setup, low yieldStudies requiring authentic plant modifications

For functional studies of respiratory chain components, baculovirus-infected insect cell systems (similar to those used for human COX-2 expression) may provide better results as they support proper folding of membrane proteins .

What purification protocol yields the highest activity for recombinant Oryza sativa COX2?

For optimal purification of active recombinant COX2 from Oryza sativa, a multi-step approach yields the best results:

  • Initial extraction: Use buffer containing 50 mM Tris (pH 8.0) with 1% mild detergent (DDM or Triton X-100) to solubilize membrane-associated protein

  • Affinity purification: If His-tagged, use Ni-NTA chromatography with imidazole gradient elution (20-250 mM)

  • Secondary purification: Size exclusion chromatography to separate aggregates and obtain homogeneous protein

  • Storage conditions: Store in 50 mM Tris buffer (pH 8.0) with 6% trehalose to maintain stability, aliquot and store at -80°C to prevent freeze-thaw cycles

The purified protein can be assessed for purity using SDS-PAGE, with expected apparent molecular weight of approximately 30 kDa .

How can researchers assess the enzymatic activity of recombinant Oryza sativa COX2?

COX2 functions as part of the cytochrome c oxidase complex, so activity assays typically measure the complete complex rather than isolated subunits. For functional studies, researchers can:

  • Incorporate purified COX2 into liposomes with other necessary subunits to reconstitute the complex

  • Measure oxygen consumption using a Clark-type oxygen electrode or fluorescence-based oxygen sensors

  • Track electron transfer using cytochrome c oxidation assays by monitoring absorbance changes at 550 nm

  • Assess membrane potential generation using potential-sensitive dyes in reconstituted systems

For comparison with human COX enzymes, activity can be measured similar to human COX-2 assays, using:

  • Fluorescent detection with Amplex Ultra Red (similar to the method described for human COX-2)

  • Monitoring oxygen consumption coupled to cytochrome c oxidation

What are the applications of recombinant Oryza sativa COX2 in plant metabolism research?

Recombinant Oryza sativa COX2 serves as a valuable tool for studying:

  • Respiratory chain function in plant mitochondria, particularly under stress conditions

  • Evolutionary adaptation of respiratory proteins across plant species

  • Structural analysis of plant-specific features of the cytochrome c oxidase complex

  • Development of mitochondrial markers for studying organelle dynamics in plant cells

  • Cross-species comparison of respiratory chain components to understand adaptation to different environmental conditions

Researchers use recombinant COX2 as a standard for quantitative assessments in Blue Native-PAGE (BN-PAGE) and Western blot applications when studying plant mitochondrial composition .

How does Oryza sativa COX2 compare to COX2 from other plant species?

Comparative analysis reveals both conserved and variable regions in COX2 across plant species:

SpeciesSequence Identity to O. sativa COX2Key DifferencesNotable Features
Arabidopsis thaliana~85%N-terminal region variationSmaller size (29.4 kDa)
Cucumis sativus~80%Metal-binding region variationsSimilar functional domains
Physcomitrella patens~75%More divergent sequencesAncient lineage comparison
Triticum aestivum~95%High conservationMonocot similarity

These differences provide insights into the evolution of respiratory complexes in plants. Conserved regions typically correspond to functional domains involved in electron transfer and oxygen binding .

Can Oryza sativa COX2 be used to study mitochondrial function across different plant species?

Yes, Oryza sativa COX2 serves as an excellent model for cross-species studies of mitochondrial function due to its:

  • High conservation of functional domains across plant species

  • Availability of antibodies that cross-react with COX2 from multiple plant species including Arabidopsis thaliana, Hordeum vulgare, Triticum aestivum, and Zea mays

  • Well-established expression systems that can be adapted for comparative studies

For mitochondrial localization studies, anti-COX2 antibodies have been successfully used as mitochondrial inner membrane markers across diverse plant species . This consistent detection makes it valuable for:

  • Comparative studies of mitochondrial respiratory efficiency

  • Analysis of evolutionary adaptations in plant respiratory systems

  • Assessment of mitochondrial responses to environmental stresses

What are common challenges in working with recombinant Oryza sativa COX2 and how can they be addressed?

Researchers frequently encounter these challenges when working with recombinant COX2:

  • Poor expression yields:

    • Solution: Optimize codon usage for expression host

    • Alternative: Use fusion partners (MBP, SUMO) to enhance solubility

  • Protein misfolding:

    • Solution: Express at lower temperatures (16-18°C)

    • Alternative: Use membrane-mimicking detergents during purification

  • Loss of activity during purification:

    • Solution: Include cofactors (heme) in purification buffers

    • Alternative: Minimize exposure to harsh conditions (extreme pH, high salt)

  • Aggregation during storage:

    • Solution: Store with 6% trehalose as a stabilizer

    • Alternative: Maintain in detergent micelles if membrane association is important

  • Difficulty distinguishing from endogenous COX2:

    • Solution: Use epitope tags for detection and quantification

    • Alternative: Employ species-specific antibodies for differential detection

What advanced techniques are being used to study structure-function relationships in Oryza sativa COX2?

Leading-edge research on Oryza sativa COX2 employs several sophisticated techniques:

  • Cryo-electron microscopy for high-resolution structural analysis of the intact cytochrome c oxidase complex

  • Site-directed mutagenesis to assess the importance of specific residues for electron transfer and oxygen binding

  • Hydrogen-deuterium exchange mass spectrometry to map conformational changes during the catalytic cycle

  • Blue Native-PAGE combined with activity staining to study complex assembly and stability

  • Reconstitution into nanodiscs for functional studies in a membrane-like environment

  • Molecular dynamics simulations to understand protein-lipid interactions and conformational dynamics

These advanced approaches provide deeper insights into how COX2 functions in the context of the complete cytochrome c oxidase complex and the mitochondrial respiratory chain.

How can researchers avoid confusion between plant COX2 and mammalian COX-2 in experimental design?

The similar abbreviations but distinct functions of plant COX2 (cytochrome c oxidase) and mammalian COX-2 (cyclooxygenase) create significant potential for confusion. Researchers should:

  • Use precise terminology in publications and protocols:

    • Refer to the rice protein as "cytochrome c oxidase subunit 2" or "Complex IV subunit 2"

    • Use full protein names in methods sections and figure legends

  • Verify reagent specificity:

    • Confirm antibody specificity against the intended target

    • Check cross-reactivity with both forms if working with heterologous systems

  • Consider distinct detection methods:

    • Plant COX2: Detected using mitochondrial function assays

    • Mammalian COX-2: Typically assessed through prostaglandin production

  • Be aware of inhibitor specificity:

    • NSAIDs and coxibs target mammalian COX-2, not plant COX2

    • Respiratory inhibitors like antimycin affect plant COX2 function

What can be learned from comparing the functional mechanisms of plant COX2 and mammalian COX-2?

Despite their different functions, studying both proteins provides interesting comparative insights:

AspectPlant COX2Mammalian COX-2Research Implications
SubstrateCytochrome c, O₂Arachidonic acidDifferent assay requirements
RegulationOxygen levels, energy demandInflammatory signalsDistinct regulatory pathways
InhibitorsCyanide, azideNSAIDs, rice-derived tricin Potential cross-inhibition in mixed samples
ExpressionConstitutiveInducibleDifferent experimental timeframes
LocalizationMitochondrial membraneER membraneSeparate subcellular fractionation

Interestingly, rice bran constituent tricin has been shown to inhibit mammalian COX-2 with IC₅₀ values of approximately 1 μmol/L, demonstrating potential crosstalk in research with mixed plant and animal systems .

How can protein-protein interactions of Oryza sativa COX2 be investigated?

Several approaches are effective for studying COX2 interactions:

  • Co-immunoprecipitation using COX2-specific antibodies to pull down interaction partners

  • Blue Native-PAGE to preserve native protein complexes for analysis of COX2 within the cytochrome c oxidase complex

  • Proximity labeling techniques (BioID, APEX) to identify proteins in close proximity to COX2 in vivo

  • Yeast two-hybrid screening with membrane-specific variants to identify direct interaction partners

  • Crosslinking mass spectrometry to map interaction interfaces within the respiratory complex

The STRING database provides a valuable resource for predicting COX2 interaction partners based on various evidence types, showing strong interactions with other respiratory chain components .

What methods are available to study the integration of recombinant COX2 into functional respiratory complexes?

Researchers can employ these methods to study COX2 integration:

  • Reconstitution experiments using purified components to rebuild functional complexes in vitro

  • Complementation studies in COX2-deficient systems to assess functional rescue

  • Activity assays comparing native versus reconstituted complexes:

    • Oxygen consumption rates

    • Electron transfer efficiency

    • Proton pumping capacity

  • Structural analysis techniques:

    • Cryo-EM of reconstituted complexes

    • Small-angle X-ray scattering for solution structure

  • Membrane integration studies using liposomes of defined composition to assess how lipid environment affects complex assembly and function

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.