Recombinant Oryza sativa subsp. japonica Cytochrome P450 734A5 (CYP734A5)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our default glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
CYP734A5; Os07g0647200; LOC_Os07g45290; OJ1316_A04.108; OsJ_25362; P0503D09.125; Cytochrome P450 734A5
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-537
Protein Length
full length protein
Species
Oryza sativa subsp. japonica (Rice)
Target Names
CYP734A5
Target Protein Sequence
MWSSWAWTWSWSGAAAVAVAAAAAWVAVYAAAARAAEALWWRPRRVERHFAAQGVRGPGY RFFVGSSIELVRLMVDAASRPMEPPTSHDILPRVLPFYHHWRKLYGPMHLIWFGRTPRLV VSEPELIREVLLTRADHFDRYEAHPMICQFEGYGLSNLHGERWARRRRVLTPAFHTENLR MIAPFVAGTVTRMLDELAERARAGGAGEAEVDVAEWFQRVPQEAITFAAFGRRNYDDGAA VFRLQDELAGYATEAHSKVYIPGYRFLPTRKNRRVWQLDREIRSHLAKFVTGLQSCSSSH GDDADDGGDGGGGMREFMSFMAPAMTAGEIIEESKNFFFAGKETLSNLLTWTTVALAMHP EWQERARREVVAVCGRGDLPTKDHLPKLKTLGMILNETLRLYPPAVAMIRTAKEDVELGG CVVPAGTEVMIPIMAVHHDAAAWGDDAAEFNPARFAADDDGGRRRHPMAFMPFGGGARVC IGQNMALMEAKVALAVVLRRFEFRLSPAYVHAPRVLMILSPQFGAPVIFRPLTSAAA
Uniprot No.

Target Background

Function
Cytochrome P450 734A5 (CYP734A5) is likely involved in brassinosteroid (BR) inactivation and the regulation of BR homeostasis.
Database Links
Protein Families
Cytochrome P450 family
Subcellular Location
Membrane; Single-pass membrane protein.
Tissue Specificity
Exclusively expressed in roots.

Q&A

What is CYP734A5 and how is it classified within the cytochrome P450 superfamily?

CYP734A5 is a cytochrome P450 monooxygenase found in Oryza sativa subsp. japonica (rice). It belongs to the CYP734A subfamily, which is part of the larger cytochrome P450 superfamily of enzymes . Cytochrome P450s are heme-containing enzymes that typically catalyze oxidation reactions in organisms. Within the CYP734A subfamily in rice, there are several members including CYP734A2, CYP734A4, CYP734A5, and CYP734A6 . These enzymes are classified based on sequence similarity and functional conservation across species. CYP734A5 shares approximately 58% sequence identity with CYP734A4 and is evolutionarily related to CYP734A1/BAS1 in Arabidopsis thaliana . The phylogenetic relationship between CYP734A5 and other members of the subfamily suggests functional specialization during the evolution of rice varieties.

What are the primary physiological roles of CYP734A5 in rice?

CYP734A5 primarily functions in brassinosteroid (BR) catabolism in rice, helping regulate endogenous levels of bioactive brassinosteroids . Brassinosteroids are essential plant hormones involved in numerous developmental processes including cell and stem elongation, skotomorphogenesis, stress responses, and tracheary element differentiation .

CYP734A5 contributes to BR homeostasis through two main mechanisms:

  • Direct inactivation of bioactive brassinosteroids such as castasterone (CS)

  • Suppression of CS biosynthesis by decreasing the levels of brassinosteroid precursors

This dual regulatory mechanism allows fine control of BR levels in different tissues and developmental stages. While CYP734A5 is expressed in shoot tissues, its expression levels may vary depending on developmental stage and environmental conditions . By controlling BR levels, CYP734A5 influences various physiological processes in rice, potentially affecting traits such as plant height, leaf angle, grain number, and stress tolerance .

How does the expression pattern of CYP734A5 relate to its function in rice development?

While the search results don't provide specific expression data for CYP734A5 alone, they do indicate that rice CYP734As, including CYP734A5, are expressed in shoot tissues . By examining related CYP734A family members, we can infer potential expression patterns for CYP734A5:

  • CYP734A6, a closely related enzyme, has been shown to be strongly expressed in the shoot apical meristem (SAM), stem, and young leaf primordia

  • Expression is also detected in meristems and young leaves of axillary buds

  • Expression domains of CYP734As often overlap with sites of active growth and development

The expression pattern of CYP734A5 likely corresponds to tissues where BR levels need precise regulation. The enzyme may be upregulated in response to elevated BR levels, as seen with other CYP734A family members that showed dramatically increased expression after BR treatment . This suggests that CYP734A5 participates in a feedback loop to maintain BR homeostasis in rice, with expression levels adjusting based on endogenous BR concentrations and developmental requirements .

What specific biochemical reactions does CYP734A5 catalyze in brassinosteroid metabolism?

CYP734A5, like other rice CYP734As, is a multifunctional enzyme capable of catalyzing several oxidation reactions in brassinosteroid metabolism . Based on the research data, CYP734A5 likely catalyzes:

  • C-26 hydroxylation of castasterone (CS) and other brassinosteroids - adding a hydroxyl group at the C-26 position of the steroid backbone

  • Second and third oxidations at C-26 to produce:

    • Aldehyde groups (second oxidation)

    • Carboxylate groups (third oxidation)

These sequential oxidation reactions effectively inactivate bioactive brassinosteroids. The enzyme has multisubstrate properties, meaning it can utilize a range of C-22 hydroxylated brassinosteroid intermediates as substrates . This broad substrate specificity allows CYP734A5 to regulate BR levels at multiple points in the biosynthetic pathway, providing versatile control over BR homeostasis.

The catalytic mechanism likely involves the heme group in the enzyme's active site, which facilitates oxygen activation and subsequent substrate oxidation, consistent with the general mechanism of cytochrome P450 enzymes .

How does the substrate specificity of CYP734A5 compare to other CYP734A family members?

Rice CYP734A family members, including CYP734A5, demonstrate notable substrate promiscuity compared to their Arabidopsis counterparts . While the specific substrate range of CYP734A5 is not individually detailed in the search results, we can make informed comparisons based on the family characteristics:

CYP734A MemberSubstrate RangePrimary ReactionExpression Pattern
CYP734A2C-22 hydroxylated BR intermediatesC-26 hydroxylationShoot tissue
CYP734A4C-22 hydroxylated BR intermediatesC-26 hydroxylationShoot tissue
CYP734A5Likely similar to other family membersC-26 hydroxylationShoot tissue
CYP734A6C-22 hydroxylated BR intermediatesC-26 hydroxylationSAM, stem, young leaf primordia
CYP734A1/BAS1 (Arabidopsis)Primarily CS and BLC-26 hydroxylationNot specified in results

Rice CYP734As collectively can utilize a wider range of BR intermediates than the Arabidopsis ortholog CYP734A1/BAS1, which primarily inactivates castasterone (CS) and brassinolide (BL) . The multisubstrate capability of rice CYP734As allows them to regulate BR levels at multiple points in the biosynthetic pathway . CYP734A5 likely shares this broad substrate specificity, making it an effective regulator of BR homeostasis in rice.

What are the structural features of CYP734A5 that determine its catalytic function?

While the search results don't provide specific structural details for CYP734A5, we can infer key structural features based on general properties of cytochrome P450 enzymes and the CYP734A subfamily:

  • Conserved heme-binding domain: Like all cytochrome P450s, CYP734A5 likely contains a conserved cysteine residue that serves as the axial ligand to the heme iron, essential for catalytic activity .

  • Substrate recognition sites (SRS): CYP734A5 would contain multiple SRS regions that determine its substrate specificity. These regions likely evolved to recognize C-22 hydroxylated brassinosteroids .

  • Membrane association domains: As a P450 enzyme, CYP734A5 is probably anchored to the endoplasmic reticulum membrane through hydrophobic regions, typically at the N-terminus .

  • Oxygen-binding pocket: The enzyme would have a specialized pocket for binding molecular oxygen, which is activated for subsequent substrate oxidation .

  • NADPH-cytochrome P450 reductase (CPR) binding interface: For electron transfer from NADPH via CPR, essential for the catalytic cycle .

Evolutionary analysis of the CYP76 subfamily (related to CYP734A) in various rice species suggests that these structural features underwent purifying selection during evolution, indicating functional conservation and importance . The biochemical versatility of CYP734A5 likely stems from structural flexibility in its substrate-binding pocket, allowing it to accommodate multiple BR intermediates and catalyze sequential oxidation reactions.

How can recombinant CYP734A5 be produced for in vitro studies?

Based on the search results, researchers can produce recombinant CYP734A5 using the following approaches:

Recombinant Expression Systems:

  • Bacterial expression: E. coli is commonly used for expressing recombinant plant P450s. For CYP734A proteins, successful expression has been achieved using fusion protein approaches :

    • MBP (Maltose Binding Protein) fusion tags

    • His-tagged protein expression

Expression and Purification Protocol:

  • Clone the full-length coding sequence of CYP734A5 from Oryza sativa subsp. japonica tissue (preferably shoot tissue where it's naturally expressed)

  • Construct an expression vector with appropriate fusion tags (MBP or His-tag) and promoter

  • Transform into an E. coli expression strain optimized for membrane proteins

  • Induce protein expression under optimized conditions

  • Lyse cells and isolate membrane fractions containing the recombinant protein

  • Solubilize with appropriate detergents

  • Purify using affinity chromatography based on the fusion tag

Functional Reconstitution:
For enzymatic assays, the purified CYP734A5 would need to be reconstituted with:

  • NADPH-cytochrome P450 reductase

  • Lipid components (for membrane environment)

  • Appropriate brassinosteroid substrates

  • NADPH as electron donor

This approach allows for biochemical characterization of substrate specificity and catalytic properties. While the search results don't provide specific details for CYP734A5 purification, similar approaches used for related CYP734A family members can be applied with appropriate modifications .

What analytical methods are effective for studying CYP734A5-catalyzed brassinosteroid metabolism?

Several analytical methods have been successfully applied to study brassinosteroid metabolism by CYP734A enzymes:

Chromatographic Methods:

  • Gas Chromatography-Mass Spectrometry (GC-MS): Used to analyze brassinosteroid components in plant tissues, particularly effective for analyzing wax components and aliphatic cutin monomers in anthers .

Biochemical Assays:

  • In vitro enzyme assays: Recombinant CYP734A5 can be incubated with various brassinosteroid substrates, and reaction products can be monitored .

  • Lamina joint bending assay: A bioassay performed at the 3-leaf stage where brassinosteroids (e.g., 24-epiBR) are applied to the joint between the lamina and leaf sheath. This assay measures BR sensitivity in plants .

Genetic and Molecular Approaches:

  • Gain- and loss-of-function studies: Overexpression or knockout of CYP734A5 using CRISPR/Cas9 to analyze phenotypic effects .

  • Quantitative real-time PCR (qRT-PCR): To measure expression levels of CYP734A5 and related genes under different conditions or treatments .

  • ChIP-seq analysis: To identify transcription factors that regulate CYP734A5 expression (as demonstrated for related CYP734A genes) .

Imaging Techniques:

  • GFP reporter constructs: For visualizing the expression pattern of CYP734A genes in plant tissues .

  • Histological analysis: To observe cellular phenotypes in transgenic plants with altered CYP734A expression .

These methods provide complementary information about CYP734A5 function, from biochemical properties to physiological roles in planta.

What genetic approaches can be used to study CYP734A5 function in vivo?

Several genetic approaches have been successfully employed to study the in vivo function of CYP734A family members, which can be applied to CYP734A5:

Gene Editing Technologies:

  • CRISPR/Cas9 system: The search results describe successful use of CRISPR/Cas9 to knock out CYP734A4, a close relative of CYP734A5 . For CYP734A5:

    • Design specific guide RNAs targeting CYP734A5 coding regions

    • Construct CRISPR/Cas9 vectors for rice transformation

    • Identify frameshift mutations through sequencing

    • Analyze phenotypic changes in knockout lines

Transgenic Approaches:

  • Overexpression studies:

    • Construct vectors with the CYP734A5 gene under the control of constitutive promoters (e.g., 35S enhancer)

    • Transform rice using Agrobacterium tumefaciens-mediated genetic transformation

    • Analyze phenotypic changes such as plant height, leaf angle, and BR sensitivity

  • RNA interference (RNAi):

    • Design RNAi constructs targeting specific regions of CYP734A5

    • Transform plants and analyze knockdown phenotypes

    • Consider potential off-target effects due to sequence similarity with other CYP734A family members

Reporter Gene Systems:

  • Promoter-reporter constructs:

    • Fuse the CYP734A5 promoter region to reporter genes like GFP

    • Analyze expression patterns in different tissues and developmental stages

    • Study promoter response to hormones and environmental stresses

Mutant Analysis:

  • T-DNA insertion libraries: Screen for insertions near or within the CYP734A5 gene

  • Chemical mutagenesis: EMS mutagenesis followed by TILLING to identify point mutations in CYP734A5

The combined use of these approaches can provide comprehensive insights into CYP734A5 function, revealing its role in BR catabolism, plant development, and stress responses in rice.

How does CYP734A5 expression respond to different environmental stresses and what are the implications for stress tolerance in rice?

While the search results don't specifically detail CYP734A5's response to environmental stresses, we can draw insights from studies on related CYP family members in rice:

Research on the CYP76 subfamily in rice, which has some functional overlap with CYP734A, revealed differential expression patterns under various abiotic stresses :

  • Drought stress: Some CYP genes showed significantly increased expression

  • Salt stress: Different expression patterns compared to drought stress

  • Flooding stress: Distinct expression patterns from other stresses

  • Cold stress: Yet another set of expression patterns

For CYP734A5 specifically, we can hypothesize that:

  • BR-mediated stress responses: Since CYP734A5 regulates BR levels, and BRs are known to induce abiotic stress tolerance in rice , CYP734A5 likely plays a role in stress adaptation.

  • Stress-specific regulation: CYP734A5 expression might be differentially regulated under various stresses to modulate BR levels appropriately for each stress condition.

  • Varietal differences: The search results indicate that CYP genes in japonica and indica rice varieties show different response patterns to the same abiotic stresses , suggesting that CYP734A5 may contribute to the differential stress tolerance observed between rice subspecies.

Future research should focus on quantifying CYP734A5 expression under different stress conditions and correlating these changes with BR levels and stress tolerance phenotypes. Engineering CYP734A5 expression could potentially be a strategy for improving stress resilience in rice varieties.

What is the relationship between CYP734A5 activity and other hormone signaling pathways in rice?

The search results suggest complex interactions between brassinosteroid metabolism (regulated by CYP734A5 and related enzymes) and other hormone signaling pathways:

Interactions with Cytokinin (CK) Signaling:

  • KNOX transcription factors that regulate CYP734A gene expression also promote cytokinin production by activating cytokinin biosynthesis enzyme genes

  • The combination of BR regulation (by CYP734As) and CK levels is critical for proper shoot meristem functions

Interactions with Gibberellin (GA) Signaling:

  • KNOX proteins that regulate CYP734A genes also lower GA levels by repressing GA biosynthesis and activating GA catabolism

  • The balance between BR (regulated by CYP734A5) and GA levels affects cell differentiation, lateral organ development, and stem cell elongation

Interactions with Auxin Signaling:

  • KNOX proteins regulate both BR catabolism genes (like CYP734A5) and the auxin pathway

  • Auxin accumulates distally in developing leaves and triggers initiation of lateral primordia, processes that may be coordinated with BR signaling

This hormone crosstalk creates a complex regulatory network where CYP734A5 participates in maintaining proper hormone balance during development. The search results suggest that local control of BR levels by CYP734A enzymes (including CYP734A5) is a key regulatory step in shoot apical meristem function and inflorescence architecture .

How does the evolution of CYP734A5 relate to adaptive traits in different rice varieties?

The evolutionary analysis of cytochrome P450 genes in rice provides insights into how CYP734A5 may have evolved in relation to adaptive traits:

Evolutionary Mechanisms:

  • Gene duplication: CYP genes like those in the CYP734A subfamily expanded mainly through segmental/whole genome duplication (SD/WGD) and tandem duplication events .

  • Purifying selection: CYP gene families have undergone strong purifying selection during evolution, suggesting functional conservation . For CYP734A5, this indicates its essential role in BR catabolism has been maintained throughout rice evolution.

Functional Divergence:

  • Subspecies differences: CYP genes in japonica and indica rice varieties show different response patterns to the same abiotic stresses . This functional divergence may contribute to the differential stress tolerance between these subspecies.

  • Expression pattern divergence: CYP genes including those in families related to CYP734A show relatively restricted expression patterns in specific tissues like leaves and roots , suggesting specialized functions in different plant parts.

Adaptive Significance:

  • Stress tolerance: The search results suggest that functional divergence in CYP gene families may be key to differences in stress tolerance between rice varieties .

  • Agronomic traits: Research on CYP734A4 (closely related to CYP734A5) showed that moderate overexpression improved grain number per main panicle and seed setting rate , suggesting that evolutionary changes in CYP734A gene regulation may have contributed to yield-related traits in domesticated rice.

Studying CYP734A5 sequence and functional variation across wild and cultivated rice species could provide insights into how BR metabolism has been shaped during rice domestication and adaptation to different environments.

How can modulating CYP734A5 expression be used to improve agronomic traits in rice?

The search results suggest several promising strategies for utilizing CYP734A5 and related enzymes to enhance agronomic traits in rice:

Yield Enhancement:
Research on the related enzyme CYP734A4 demonstrated that moderate overexpression led to several beneficial traits:

  • Increased grain number per main panicle

  • Improved seed setting rate

  • No significant reduction in plant fertility

This suggests that carefully calibrated expression of CYP734A5 could potentially achieve similar yield improvements.

Plant Architecture Modification:
Manipulating CYP734A5 expression could alter BR levels to optimize:

  • Leaf angle: Reduced angles can lead to more erect leaves, which improves light penetration and photosynthetic efficiency in dense plantings

  • Plant height: More compact plants with improved lodging resistance

  • Tillering patterns: Potentially increasing productive tillers

Implementation Strategies:

  • Promoter engineering: Using moderately strong or tissue-specific promoters to achieve optimal CYP734A5 expression levels without severe BR deficiency

  • CRISPR-based approaches:

    • Base editing of promoter regions to fine-tune expression

    • Multiplex editing targeting both CYP734A5 and other BR metabolism genes for balanced regulation

  • Variety-specific optimization: Since japonica and indica varieties show different hormone responses , CYP734A5 manipulation strategies would need to be tailored to specific genetic backgrounds.

What challenges exist in translating CYP734A5 research findings to practical applications in rice improvement?

Despite the promising potential of CYP734A5 manipulation for rice improvement, several challenges must be addressed:

Dosage Sensitivity:

  • Narrow optimal expression window: The search results indicate that while moderate overexpression of CYP734A genes can improve agronomic traits, strong overexpression causes severe BR-deficient phenotypes . This creates a technical challenge in achieving consistent, optimal expression levels.

  • Pleiotropic effects: BR deficiency affects multiple developmental processes, potentially causing unintended consequences even when targeting specific traits .

Functional Redundancy:

  • Overlapping functions: CYP734A family members show functional redundancy, as evidenced by the lack of obvious phenotypes in single gene knockouts . This suggests that manipulating CYP734A5 alone might have limited impact.

  • Compensatory mechanisms: Plants have homeostatic mechanisms that may counteract engineered changes in BR metabolism, potentially dampening the intended effects .

Environmental Interactions:

  • Variable stress responses: CYP gene expression responds differently to environmental stresses in different rice varieties , suggesting that CYP734A5 modifications might perform inconsistently across environments.

  • Genotype-environment interactions: The optimal level of CYP734A5 expression likely varies with growing conditions, complicating the development of broadly adapted varieties.

Technical and Regulatory Hurdles:

  • Precision engineering requirements: Achieving the right expression level in the right tissues requires sophisticated molecular tools and extensive testing .

  • Regulatory considerations: Crops with genome edits face varying regulatory scrutiny in different regions, potentially limiting deployment.

Addressing these challenges requires integrative approaches combining precise gene editing, comprehensive phenotyping across environments, and systems biology understanding of hormone crosstalk.

How does CYP734A5 research contribute to our understanding of brassinosteroid homeostasis in cereals beyond rice?

Research on CYP734A5 in rice provides valuable insights that extend to brassinosteroid homeostasis in other cereals:

Evolutionary Conservation:

  • Comparative genomics: The search results mention a comparison of ChIP-seq data between rice and maize that suggests evolutionarily conserved regulation of BR catabolism genes . This indicates that findings about CYP734A5 in rice may have direct relevance to maize and potentially other cereals.

  • Functional conservation: The multifunctional, multisubstrate properties of rice CYP734As suggest similar enzymatic versatility may exist in other cereal species .

Regulatory Networks:

  • Transcription factor conservation: KNOX transcription factors regulate BR catabolism genes in both rice and maize , suggesting conserved regulatory networks across cereals.

  • Hormone crosstalk: The complex interactions between BR, auxin, cytokinin, and gibberellin signaling revealed in rice likely represent fundamental mechanisms shared across grass species .

Developmental Control:

  • Meristem regulation: CYP734A-mediated BR inactivation is important for shoot apical meristem function in rice , suggesting similar mechanisms may operate in other cereals.

  • Inflorescence architecture: CYP734A genes influence panicle branch angles in rice , a finding that could be relevant to understanding inflorescence development in other grasses with different branching patterns.

Agricultural Applications:

  • Transferable strategies: Successful approaches to modulating CYP734A5 in rice could inform similar efforts in wheat, barley, and other cereals.

  • Broad crop improvement: The connection between BR catabolism and agronomic traits like grain number and seed setting rate in rice suggests targeting homologous genes in other cereals might yield similar benefits.

By elucidating the fundamental mechanisms of BR homeostasis in a model cereal, CYP734A5 research contributes to a broader understanding of hormone regulation across the economically vital grass family.

What are the most recent advances in understanding CYP734A5 function and regulation?

Based on the search results, recent advances in understanding CYP734A5 and related CYP734A enzymes include:

Regulatory Mechanisms:

  • Transcriptional control: The identification of KNOX transcription factors as direct regulators of CYP734A genes, revealing that the rice KNOX transcription factor OSH1 negatively regulates the BR phytohormone pathway through activation of BR catabolism genes including CYP734As .

  • Hormone-responsive expression: Discovery that CYP734A gene expression is dramatically increased after BR treatment, confirming a feedback regulatory mechanism where BR induces its own catabolism .

Functional Characterization:

  • Multifunctional activity: Recent biochemical studies have demonstrated that rice CYP734As function as multifunctional enzymes capable of catalyzing not just hydroxylation but also further oxidations to produce aldehyde and carboxylate groups at C-26 .

  • Multisubstrate properties: Experimental evidence showing that CYP734As can utilize a range of C-22 hydroxylated brassinosteroid intermediates as substrates, not just end-pathway bioactive BRs .

Agronomic Implications:

  • Yield components: Novel findings that moderate overexpression of CYP734A genes can improve grain number per main panicle and seed setting rate in rice, traits that had not been previously reported in other BR-deficient mutants .

  • Plant architecture: Research demonstrating that CYP734A manipulation affects leaf angle and plant height, key traits for modern rice architecture .

These advances have significantly expanded our understanding of how CYP734A5 and related enzymes function in BR metabolism and plant development, opening new avenues for crop improvement.

What technological advances are driving new discoveries in CYP734A5 research?

Several cutting-edge technologies have accelerated research on CYP734A5 and related enzymes:

Genome Editing Technologies:

  • CRISPR/Cas9 system: The search results describe successful application of CRISPR/Cas9 to knockout CYP734A4, demonstrating the utility of this precise genome editing tool for studying CYP734A gene function . This technology enables:

    • Targeted gene knockouts with minimal off-target effects

    • Multiplex editing of several BR pathway genes simultaneously

    • Promoter editing for fine-tuning expression levels

Genomics Approaches:

  • ChIP-seq combined with transcriptome analyses: This powerful combination identified direct targets of transcription factors that regulate CYP734A genes , revealing:

    • Binding sites in promoter and regulatory regions

    • Temporal dynamics of gene activation

    • Integration with broader transcriptional networks

  • Genome-wide analysis across multiple species: Comparative studies of CYP gene families across seven AA genome rice species have provided evolutionary insights into functional diversification .

Advanced Analytical Methods:

  • Recombinant protein expression systems: Production of recombinant CYP734A proteins as MBP fusion proteins and his-tagged proteins has enabled detailed biochemical characterization .

  • GC-MS analysis: Sensitive detection methods for brassinosteroid metabolites allowing quantification of castasterone and other BR intermediates in plant tissues .

Imaging and Reporter Systems:

  • GFP reporter constructs: Visualization of gene expression patterns in planta, revealing the spatial distribution of CYP734A expression in specific tissues and developmental stages .

These technological advances are transforming our ability to study and manipulate CYP734A5, leading to more precise understanding of its function and potential applications.

What are the most promising future research directions for CYP734A5 studies?

Based on the current state of research, several promising directions for future CYP734A5 studies emerge:

Structural Biology:

  • Protein structure determination: Resolving the three-dimensional structure of CYP734A5 would provide insights into:

    • Substrate binding mechanisms

    • Catalytic versatility

    • Structure-function relationships

    • Opportunities for protein engineering

Systems Biology:

  • Hormone crosstalk networks: Investigating how CYP734A5-mediated BR catabolism integrates with other hormone signaling pathways to regulate development .

  • Tissue-specific metabolic profiling: Comprehensive analysis of BR intermediates and products in different tissues and developmental stages to map the dynamic role of CYP734A5.

Precision Breeding:

  • Allele mining: Exploring natural variation in CYP734A5 across diverse rice germplasm to identify beneficial alleles for breeding.

  • Fine-tuned expression engineering: Developing promoter variants that achieve optimal CYP734A5 expression levels for improved agronomic traits without negative side effects .

  • Conditional regulation: Creating switch-inducible CYP734A5 expression systems that activate only under specific developmental or environmental conditions.

Stress Biology:

  • Abiotic stress responses: Investigating how CYP734A5 expression responds to different environmental stresses and how this affects BR-mediated stress tolerance .

  • Climate resilience: Exploring how manipulating CYP734A5 might enhance adaptation to climate change-related stresses.

Translational Research:

  • Field validation: Testing CYP734A5-modified rice lines under diverse field conditions to evaluate yield stability and environmental interactions.

  • Crop transfer: Applying knowledge from rice CYP734A5 to manipulate orthologous genes in other cereals for similar agronomic benefits.

These research directions would contribute to both fundamental understanding of BR metabolism and practical applications in crop improvement, particularly in addressing the challenges of sustainable food production under changing environmental conditions.

What are the key takeaways from current CYP734A5 research for the scientific community?

The current body of research on CYP734A5 and related enzymes offers several significant takeaways for the scientific community:

  • Multifunctional enzyme properties: Rice CYP734A5 belongs to a subfamily of enzymes that function as multisubstrate and multifunctional catalysts, capable of inactivating a range of brassinosteroid intermediates through sequential oxidation reactions . This biochemical versatility highlights the sophisticated control mechanisms plants have evolved for hormone homeostasis.

  • Regulatory complexity: CYP734A5 expression is regulated by transcription factors like KNOX proteins and responds to BR levels through feedback mechanisms , illustrating the intricate regulatory networks controlling plant development.

  • Developmental significance: BR catabolism by CYP734A enzymes is critical for proper shoot meristem function, leaf development, and inflorescence architecture in rice , demonstrating the importance of local hormone inactivation for plant morphogenesis.

  • Agricultural potential: Moderate manipulation of CYP734A gene expression can improve important agronomic traits like grain number and seed setting rate , providing new targets for crop improvement that differ from traditional BR biosynthesis genes.

  • Evolutionary insights: Functional divergence in CYP genes between rice subspecies contributes to their differential responses to environmental conditions , revealing how metabolism has been shaped during adaptation and domestication.

These findings collectively expand our understanding of the mechanisms controlling plant growth and development while offering tangible opportunities for crop enhancement through targeted manipulation of hormone metabolism.

How does CYP734A5 research exemplify the integration of basic and applied plant science?

CYP734A5 research exemplifies the seamless integration of basic and applied plant science through several aspects:

  • From mechanism to manipulation: The fundamental understanding of CYP734A5's biochemical function in BR catabolism has directly informed strategies to manipulate plant architecture and yield components through genetic engineering .

  • Evolutionary insights informing breeding: Research on the evolutionary history and functional divergence of CYP genes provides insights into how natural variation might be exploited in breeding programs targeting different environments.

  • Developmental biology driving agronomic improvement: Discoveries about the role of BR catabolism in shoot meristem function and boundary formation have revealed unexpected connections to agriculturally important traits like panicle branch angles and grain number .

  • Molecular tools enabling precision agriculture: The application of advanced genomic technologies like CRISPR/Cas9 for studying CYP734A5 function demonstrates how cutting-edge basic research tools can be rapidly deployed for crop improvement.

  • Systems understanding for targeted intervention: The elucidation of hormone crosstalk networks involving CYP734A5 and related enzymes allows for more sophisticated, precise interventions rather than crude hormone applications or severe genetic disruptions.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.