Recombinant Oryza sativa subsp. japonica Cytochrome P450 99A2 (CYP99A2)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please consult your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice shipping is specifically requested and agreed upon in advance (additional fees apply).
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and may serve as a useful reference for your preparations.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer components, temperature, and the protein's inherent stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The specific tag type is determined during production. If a specific tag is required, please inform us to prioritize its inclusion in the manufacturing process.
Synonyms
CYP99A2; Os04g0180400; LOC_Os04g10160; OSJNBa0027O01.2; OSJNBa0052P16.24; Cytochrome P450 99A2
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-532
Protein Length
full length protein
Species
Oryza sativa subsp. japonica (Rice)
Target Names
CYP99A2
Target Protein Sequence
MQFFAKQNCQVNLLTNNPSSNPRFIMEINSAATLTLVSLLTLPILLALLTRKSSSKKRRP PGPWNLPLVGGLLHLLRSHPQVALRELASKYGPVMFLRMGQIDTVVVSSPAAAQEVLRDK DVMFASRPSLLVSEIFCYDNLDVGFAPYGAYWRMLRKLCTVELLSTKVVRQLAPVRNDET LTLVRNIKAASSGHGGGGGKKPVTLARLLTTCTNTITAKAAFGQACGVELQEQFLTALDV GLKFSGGFCFGDLFPSLRFIDAMTGLRSRLWRARGQLDSVFDKIIAQCEEHQGDSLVNVL LRIRDQGDLEFPFGTTNIKAIILDMFTGGTETTSSAAEWVMSELMRNPEVMAKVQAEVRR VFDNKSPQDHEGLIDNLRYMKMVIKETMRLNPVLPLLMPHLCRETCDIGGYEVVEGTRVV INSWAMARSPEYWDDAEEFKPERFEDGMADYKGSRFEYLPFGTGRRRCPGDTFGMVLLEL IVARLLYYFDWSLPAGMQPDDVDMDFVVTATTRRKNHLQLVASPYKLAPIQI
Uniprot No.

Target Background

Function

Recombinant Oryza sativa subsp. japonica Cytochrome P450 99A2 (CYP99A2) is involved in momilactone phytoalexin biosynthesis. It participates in the biosynthetic pathway between 9-β-pimara-7,15-diene and 3-β-hydroxy-9-β-pimara-7,15-dien-19,6-β-olide.

Database Links
Protein Families
Cytochrome P450 family
Subcellular Location
Membrane; Multi-pass membrane protein.

Q&A

What is CYP99A2 and what is its role in rice metabolism?

CYP99A2 is a cytochrome P450 monooxygenase encoded by the rice genome and located on chromosome 4. It belongs to the biosynthetic gene cluster (BGC) associated with momilactone production, which serves as both phytoalexins and allelochemicals in rice . While CYP99A2 has been implicated in momilactone biosynthesis based on RNA interference studies showing that double knock-down of CYP99A2 and CYP99A3 reduced momilactone accumulation, its precise catalytic function differs from its paralog CYP99A3 .

Biochemical characterization reveals that CYP99A2 exhibits limited enzymatic activity with diterpene substrates compared to CYP99A3. When tested with syn-pimaradiene (a momilactone precursor), CYP99A2 showed only trace formation of putative diterpenoid alcohols, unlike CYP99A3 which catalyzes consecutive oxidations of the C19 methyl group . This suggests CYP99A2 might act later in momilactone biosynthesis or have a more specialized role that remains to be fully elucidated.

How does CYP99A2 expression respond to environmental stresses?

CYP99A2 expression is stress-responsive, particularly to biotic and abiotic challenges. Research indicates that CYP99A2 exhibits substantially higher expression/transcript levels than CYP99A3 in stress conditions . The momilactone biosynthetic pathway is activated as part of plant defense responses, with gene expression increasing after exposure to various stressors.

For example, methyl jasmonate treatment is commonly used to induce expression of defense-related genes in rice. Plants treated with 0.2% (v/v) methyl jasmonate show upregulated expression of genes in the momilactone biosynthetic pathway compared to control plants treated only with 0.1% Tween 20 carrier solution . Similarly, treatment with CuCl₂ induces momilactone production, which is associated with increased expression of biosynthetic genes including CYP99A2 .

What is the genomic organization of CYP99A2?

CYP99A2 is part of a biosynthetic gene cluster (BGC) located on rice chromosome 4, which contains several genes involved in momilactone production. This cluster represents one of two unlinked BGCs in rice involved in diterpenoid phytoalexin metabolism . The momilactone biosynthetic gene cluster typically contains:

  • CPS4 (copalyl diphosphate synthase)

  • KSL4 (kaurene synthase-like)

  • CYP99A2 and CYP99A3 (cytochrome P450s)

  • MAS (momilactone A synthase)

The clustering of these genes is evolutionarily significant and facilitates coordinated expression in response to stresses. The organization of this gene cluster varies across Oryza species, with lineage-specific rearrangements, gene copy number variation, pseudogenization, and gene loss events . In some species, such as O. coarctata, additional CYP genes not belonging to the CYP99A subfamily are found within the cluster .

What challenges exist in expressing functional recombinant CYP99A2 and how can they be overcome?

Expressing functional recombinant CYP99A2 presents significant challenges that have hampered its biochemical characterization. Key challenges and solutions include:

Challenges:

  • Poor expression in heterologous systems

  • Misfolding of the recombinant protein

  • Lack of enzymatic activity with native gene constructs

Solutions:

  • Complete gene recoding: Research demonstrates that complete gene recoding with codon optimization for the expression host (e.g., E. coli) can enable functional expression. While native CYP99A2 gene constructs showed no enzymatic activity with diterpene substrates, synthetic codon-optimized versions exhibited trace activity .

  • N-terminal modification: Modification of the N-terminal region can improve expression and functionality. In successful studies, researchers removed 34 codons from the 5' end of the CYP99A2 open reading frame and added ten new codons (encoding the amino acid sequence "MAKKTSSKGK") to create a modified construct with improved expression characteristics .

  • CO-binding difference spectra analysis: This technique can be used to assess proper folding of recombinant cytochrome P450s. The native gene constructs show prominent peaks at 420 nm without the characteristic peak at 450 nm, indicating misfolding, while synthetic gene constructs exhibit peaks at 450 nm, confirming some proportion of correctly folded enzyme .

  • Co-expression with CPR: Co-expression with a compatible NADPH-cytochrome P450 reductase (e.g., OsCPR1) is essential to ensure proper electron transfer for enzymatic activity .

How does CYP99A2 activity differ from CYP99A3 and what are the implications for momilactone biosynthesis?

Despite their close evolutionary relationship (84% identity at the amino acid level), CYP99A2 and CYP99A3 exhibit markedly different catalytic activities:

CYP99A3 activity:

  • Catalyzes consecutive oxidations of the C19 methyl group of syn-pimara-7,15-diene

  • Forms, sequentially, syn-pimaradien-19-ol, syn-pimaradien-19-al, and syn-pimaradien-19-oic acid

  • Also catalyzes similar oxidations of syn-stemod-13(17)-ene, albeit with lower catalytic efficiency

  • Has measurable kinetic parameters: kcat = 46 ± 2 s-1, KM = 2.0 ± 0.5 µM with syn-pimaradiene substrate

CYP99A2 activity:

  • Shows only trace formation of putative diterpenoid alcohols with syn-pimaradiene

  • Hydroxylates syn-pimaradiene at a different position than CYP99A3

  • May act later in momilactone biosynthesis rather than at the initial oxidation steps

Implications for biosynthesis:
The C19 carboxylic acid moiety produced by CYP99A3 is required for formation of the core 19,6-γ-lactone ring structure in momilactones. CYP99A2 may be involved in other hydroxylation steps of momilactone biosynthesis, such as hydroxylation at the C6β or C3α positions, or it may be functionally redundant or even non-functional . The presence of both genes in the cluster across various Oryza species suggests evolutionary significance, though their precise functional relationship remains to be fully characterized.

How has the momilactone biosynthetic gene cluster (including CYP99A2) evolved across different Oryza species?

The evolution of the momilactone biosynthetic gene cluster (MBGC) across Oryza species reveals a complex pattern of conservation, diversification, and loss:

Evolutionary history:

  • The MBGC was established in Oryza before the domestication of rice

  • It is highly conserved among AA and BB genome type Oryza species

  • Only a partial cluster exists in the early-divergent O. brachyantha (FF), which harbors only two clustered CYP99A2/3 paralogs

  • The MBGC is not restricted to AA and BB lineages; MBGC-like clusters are found in Oryza CC species and in one of the sub-genomes of tetraploid species O. alta, as well as in O. coarctata (a basal lineage in the Oryza phylogeny)

Species-specific variations:

  • Gene copy numbers vary across species, with evidence of lineage-specific duplications

  • In O. officinalis (CC), the cluster (approximately 385 kb in length) contains CPS4, MAS, two copies of KSL4, and two CYP99A2/3 orthologs

  • O. eichingeri and O. rhizomatis (both CC) have variable gene arrangements and duplications

  • In O. coarctata, an extra gene encoding a CYP that does not belong to the CYP99A subfamily is located between MAS and KSL4, resembling the cluster architecture of Echinochloa crus-galli

What expression systems are optimal for producing active recombinant CYP99A2?

Several expression systems have been evaluated for recombinant CYP99A2 production, with varying degrees of success:

1. Insect cell (Spodoptera frugiperda) expression system:

2. Bacterial (E. coli) expression system:

  • Requires synthetic codon-optimized gene constructs

  • N-terminal modification (removal of 34 codons and addition of 10 new codons) improves expression

  • Co-expression with OsCPR1 (rice P450 reductase) is crucial for activity

  • Can be integrated into modular metabolic engineering systems that co-express diterpene synthases for substrate production

  • Has enabled trace activity detection with syn-pimaradiene

3. Mammalian cell expression system:

  • Commercial recombinant CYP99A2 products using mammalian cell expression are available

  • May offer advantages for certain applications requiring post-translational modifications

Recommended approach:
For functional studies, the E. coli expression system with synthetic codon-optimized genes, N-terminal modification, and co-expression with OsCPR1 has shown the most promise for producing active CYP99A2, albeit with limited activity. The key steps include:

  • Complete gene recoding optimized for E. coli expression

  • N-terminal modification (removing membrane-spanning domain, adding optimized sequence)

  • Co-expression with OsCPR1 for electron transfer

  • Optional integration into metabolic engineering systems for in vivo substrate production

What analytical techniques are most suitable for characterizing CYP99A2 products?

Several complementary analytical techniques are essential for comprehensive characterization of CYP99A2 products:

Gas Chromatography-Mass Spectrometry (GC-MS):

  • Primary method for analyzing diterpenoid products

  • Sample preparation: Extract reaction mixtures with hexane or ethyl acetate; concentrate; analyze directly or after derivatization

  • Methylation with diazomethane is recommended for carboxylic acid products before GC-MS analysis

  • Can detect trace formation of diterpenoid alcohols from CYP99A2 activity with syn-pimaradiene

Liquid Chromatography-Tandem Mass Spectrometry (LC-MS/MS) or Ultra-High-Performance Liquid Chromatography (UHPLC)-MS/MS:

  • Essential for detecting momilactones and related compounds in plant tissues

  • Particularly valuable for compounds that may be thermally labile or have poor volatility

  • Used successfully to detect momilactones A and B in plant samples after CuCl₂ treatment

CO-Binding Difference Spectra:

  • Critical for evaluating proper folding of recombinant cytochrome P450s

  • Prepare microsomal fractions from recombinant cells

  • Compare spectra from native versus synthetic gene constructs

  • Properly folded P450s exhibit characteristic peak at 450 nm

  • Misfolded variants show peak at 420 nm

Nuclear Magnetic Resonance (NMR) Spectroscopy:

  • Essential for complete structural elucidation of novel metabolites

  • Requires purification and concentration of sufficient quantities of product

  • 1H, 13C, and 2D experiments (COSY, HSQC, HMBC) for determining exact positions of modifications

Methodological workflow:

  • Perform in vitro or in vivo enzymatic reactions with recombinant CYP99A2

  • Extract products with organic solvents (hexane/ethyl acetate)

  • Analyze directly by LC-MS/MS for preliminary detection

  • For GC-MS analysis, derivatize carboxylic acids by methylation

  • Confirm identity by comparison with authentic standards when available

  • For novel products, isolate by preparative HPLC and perform NMR characterization

How can CRISPR/Cas9 genome editing be utilized to study CYP99A2 function in planta?

CRISPR/Cas9 genome editing offers powerful approaches for investigating CYP99A2 function in rice plants:

Target strategies:

Methodological considerations:

  • Design guide RNAs targeting specific regions of CYP99A2

  • For complete cluster deletion, design guides targeting flanking regions (has been successfully accomplished for rice diterpenoid BGCs)

  • Transform rice protoplasts or calli using established Agrobacterium-mediated methods

  • Screen for homozygous mutations in the T1 generation

  • Validate mutations by sequencing

  • Assess phenotypes across multiple independent lines

Experimental readouts:

  • Analyze phytoalexin production by LC-MS/MS after pathogen challenge or elicitor treatment

  • Assess susceptibility to pathogens (e.g., Magnaporthe oryzae, Xanthomonas oryzae)

  • Evaluate allelochemical potential against competing species

  • Perform transcriptomic analysis to identify compensatory responses

As demonstrated in related research, CRISPR/Cas9 multiplex targeting can be used to remove entire biosynthetic gene clusters, yielding lines that are viable and genetically stable in homozygous form. This enables comprehensive chemotypic and phenotypic investigation of gene cluster function .

What in vitro enzymatic assay conditions are optimal for assessing CYP99A2 activity?

Establishing optimal in vitro assay conditions is crucial for detecting the relatively low activity of CYP99A2:

Enzyme source preparation:

  • Express recombinant CYP99A2 (codon-optimized) with OsCPR1 in E. coli

  • Prepare either crude lysates or microsomal fractions

  • Assess P450 concentration by CO-difference spectroscopy (A450-A490)

Reaction components:

  • Buffer: 100 mM HEPES (pH 7.4)

  • Cofactor regeneration system: 1 mM NADPH or NADPH regeneration system (1 mM NADP+, 10 mM glucose-6-phosphate, 1 U/mL glucose-6-phosphate dehydrogenase)

  • Substrate: 50-100 µM syn-pimaradiene or other potential diterpene substrates

  • Additional components: 1 mM DTT, 10% glycerol, 0.1 mM MgCl₂

  • Optional: Catalase (100 U/mL) to prevent oxidative damage

Reaction conditions:

  • Temperature: 30°C (optimal for many plant P450s)

  • Duration: 30-60 minutes for initial screening; up to 6 hours for product accumulation

  • Agitation: Gentle shaking to facilitate substrate access and prevent protein denaturation

  • Scale: 500 µL to 1 mL for analytical assays; larger volumes for product isolation

Product analysis:

  • Extract reaction products with ethyl acetate (3× with equal volumes)

  • Dry organic phase under nitrogen

  • For GC-MS analysis, methylate with diazomethane prior to analysis

  • For LC-MS, reconstitute in appropriate solvent (e.g., 50% methanol/water)

Kinetic analysis considerations:
While CYP99A3 has well-characterized kinetic parameters (kcat = 46 ± 2 s−1, KM = 2.0 ± 0.5 μM with syn-pimaradiene), CYP99A2 exhibits only trace activity, making traditional Michaelis-Menten kinetics difficult to determine . For low-activity enzymes like CYP99A2, longer incubation times and more sensitive detection methods may be necessary.

How can understanding CYP99A2 contribute to crop improvement strategies?

Understanding CYP99A2 and the momilactone biosynthetic pathway has several potential applications for crop improvement:

Disease resistance engineering:

  • Momilactones function as phytoalexins, protecting rice against pathogens

  • Modulating CYP99A2/CYP99A3 expression could enhance disease resistance

  • Research shows that syn-CPP-derived (OsCPS4-dependent) labdane-related diterpenoids play roles in nonhost disease resistance to Magnaporthe poae and other pathogens

  • Engineering momilactone production in other crop species could confer novel disease resistance traits

Allelopathy enhancement:

  • Momilactones serve as allelochemicals that inhibit the growth of competing plants

  • Enhanced production could reduce weed competition in agricultural settings

  • Rice cultivars with high allelopathic potential (e.g., PI312777) show upregulation of genes involved in specialized metabolite production compared to cultivars with low allelopathic potential (e.g., Lemont)

  • Marker-assisted selection for optimal CYP99A2 expression could help develop cultivars with enhanced weed suppression abilities

Inter-subspecific hybridization:

  • Understanding subspecies differences in specialized metabolism could inform breeding strategies

  • Indica-japonica hybrid rice development represents a promising direction for yield improvement

  • Metabolic engineering of specialized metabolites could contribute to hybrid vigor

  • Knowledge of cytochrome P450 functions in different rice subspecies could enable targeted trait introgression

Synthetic biology approaches:

  • The momilactone biosynthetic gene cluster could be transferred to other species

  • Engineered microorganisms expressing optimized CYP99A2/CYP99A3 could produce valuable diterpenoids

  • Construction of minimized biosynthetic pathways could enable production of novel bioactive compounds

What research gaps remain in our understanding of CYP99A2 structure and function?

Despite progress in characterizing CYP99A2, several significant knowledge gaps remain:

Structural basis for functional differences:

  • Crystal structures of CYP99A2 and CYP99A3 have not been reported

  • Homology modeling coupled with site-directed mutagenesis could identify critical amino acid residues responsible for the different catalytic activities

  • Comparative structural analysis could reveal why CYP99A2 shows limited activity compared to CYP99A3 despite 84% sequence identity

Potential substrates beyond syn-pimaradiene:

  • CYP99A2 shows limited activity with syn-pimaradiene, suggesting it might act on different substrates

  • It could potentially catalyze later steps in momilactone biosynthesis, acting on more complex intermediates

  • Comprehensive substrate screening with various momilactone pathway intermediates is needed

Regulatory mechanisms:

  • While stress induction of CYP99A2 is established, the specific transcription factors and cis-regulatory elements controlling its expression require further investigation

  • The coordination of expression with other cluster genes remains incompletely understood

  • Epigenetic regulation of the momilactone biosynthetic gene cluster has not been thoroughly explored

Protein-protein interactions:

  • Potential physical interactions between CYP99A2 and other enzymes in the momilactone pathway have not been characterized

  • Formation of metabolons (multi-enzyme complexes) could influence enzymatic activity and metabolic channeling

  • Interaction with membrane structures and cellular compartmentalization may affect function

Evolution and neofunctionalization:

  • The evolutionary forces driving the maintenance of both CYP99A2 and CYP99A3 in the cluster despite their different activities remain unclear

  • Comparative analysis across more Oryza species and wild relatives could reveal selection pressures

  • Investigation of potential alternative functions beyond momilactone biosynthesis is warranted

Addressing these research gaps would provide a more comprehensive understanding of CYP99A2's role in rice specialized metabolism and could unlock new applications in metabolic engineering and crop improvement.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.