Recombinant Oryza sativa subsp. japonica Defender against cell death 1 (DAD1)

Shipped with Ice Packs
In Stock

Description

Introduction to Oryza sativa DAD1

Defender against cell death 1 (DAD1) is a highly conserved protein found across numerous plant species, including rice (Oryza sativa subsp. japonica). The protein was initially identified for its crucial role in preventing programmed cell death or apoptosis. In rice, DAD1 functions as a component of the oligosaccharyltransferase complex and participates in essential cellular processes related to protein glycosylation and stress responses. The recombinant form of this protein has become increasingly important for research applications aimed at understanding plant defense mechanisms and cellular processes .

DAD1 belongs to the DAD/OST2 family of proteins and is recognized for its evolutionary conservation across different species. The rice DAD1 protein (OsDAD1) contains 114 amino acids and functions as an integral membrane protein, primarily localized in the endoplasmic reticulum. Its fundamental role in preventing cell death makes it a protein of significant interest in both basic research and applied agricultural sciences focused on improving crop resilience.

Physical and Biochemical Properties

The recombinant DAD1 protein produced for research applications is typically generated with a His-tag to facilitate purification and detection. The commercially available form often exhibits the following properties:

PropertySpecification
SpeciesOryza sativa subsp. japonica (Rice)
SourceE. coli expression system
TagHis (N-terminal)
Protein LengthFull Length (1-114 amino acids)
FormLyophilized powder
Purity>90% (determined by SDS-PAGE)
ApplicationsSDS-PAGE, functional assays
Storage BufferTris/PBS-based buffer, 6% Trehalose, pH 8.0
UniProt IDQ0JDK9

This recombinant protein exhibits high stability when properly stored and handled according to recommended protocols, making it suitable for various research applications .

Role in Glycosylation

DAD1 serves as a critical component of the N-oligosaccharyl transferase (OST) enzyme complex. This complex catalyzes the transfer of high mannose oligosaccharides from lipid-linked oligosaccharide donors to asparagine residues within the Asn-X-Ser/Thr consensus motif in nascent polypeptide chains . This N-glycosylation process occurs cotranslationally, and the complex associates with the Sec61 complex at the channel-forming translocon complex that facilitates protein translocation across the endoplasmic reticulum.

The specific catalytic activity can be described as:
Dolichyl diphosphooligosaccharide + protein L-asparagine → dolichyl diphosphate + glycoprotein with oligosaccharide chain attached by N-glycosyl linkage to protein L-asparagine .

Anti-Apoptotic Function

As its name suggests, Defender against cell death 1 plays a crucial role in preventing programmed cell death or apoptosis. Loss of DAD1 protein triggers apoptotic pathways, suggesting its importance in maintaining cellular viability under various stress conditions . This function is particularly significant in the context of plant defense responses, where controlled cell death can be either beneficial (hypersensitive response) or detrimental to plant survival depending on the context.

Expression Systems and Purification

The recombinant Oryza sativa DAD1 protein is typically produced using bacterial expression systems, most commonly E. coli. The protein is engineered with an N-terminal His-tag to facilitate purification through affinity chromatography . The purification process typically yields a product with greater than 90% purity as determined by SDS-PAGE analysis.

The production protocol involves:

  1. Cloning the DAD1 gene from Oryza sativa subsp. japonica into an appropriate expression vector

  2. Transforming the construct into E. coli

  3. Inducing protein expression

  4. Cell lysis and extraction

  5. Affinity purification using the His-tag

  6. Further purification steps as needed to achieve desired purity

  7. Lyophilization for stable storage

Role in Stress Response

The DAD1 protein plays a significant role in plant stress responses, particularly in relation to pathogen defense. Research suggests that DAD1 may be involved in regulating cell death pathways that are activated during plant-pathogen interactions. This regulation is crucial for determining whether a plant exhibits resistance or susceptibility to specific pathogens .

In rice, DAD1 appears to participate in defense signaling networks that respond to various biotic and abiotic stresses. The protein's anti-apoptotic functions may help modulate the extent of programmed cell death during hypersensitive responses, which are a common plant defense mechanism involving localized cell death at infection sites to restrict pathogen spread.

Interaction with Immune Signaling Pathways

While direct research on rice DAD1's involvement in immune signaling is limited in the provided search results, studies on related plant defense mechanisms suggest potential connections. For instance, research on Oryza sativa Pto-interacting protein 1a (OsPti1a) indicates that this protein functions as a negative regulator of both MAMP-triggered immunity (MTI) and effector-triggered immunity (ETI) in rice .

This regulatory role in immune signaling suggests a complex interplay between various proteins, potentially including DAD1, in orchestrating appropriate defense responses. The anti-apoptotic function of DAD1 could be particularly relevant in contexts where regulated cell death is a component of the defense strategy.

Evolutionary Conservation

DAD1 is a highly conserved protein across different species, indicating its fundamental importance in cellular processes. Comparative analysis with DAD1 orthologues from other organisms reveals significant sequence homology and functional conservation. For example, the DAD1 orthologue from the Asian rice gall midge (OoDAD1) shows considerable similarity to DAD1 proteins from other species .

Research has shown that the OoDAD1 exhibits a high degree of homology (94.6%) with the DAD1 orthologue from the Hessian fly (Mayetiola destructor), suggesting evolutionary conservation among dipteran insects that interact with plants . This conservation extends to the functional domains and structural features that enable DAD1 proteins to perform their anti-apoptotic and glycosylation-related roles.

Functional Implications in Host-Pathogen Interactions

Interestingly, studies on the Asian rice gall midge have revealed that the expression of OoDAD1 is significantly upregulated when the insect feeds on resistant rice varieties. In maggots feeding on resistant rice hosts, OoDAD1 expression showed a steep increase of more than 8-fold at 24 hours after infestation compared to those feeding on susceptible varieties . This suggests that DAD1 may play a crucial role in the insect's response to host defense mechanisms.

This research provides insights into how DAD1 might function in the context of plant-pathogen interactions, potentially informing our understanding of the rice DAD1 protein's role in defense responses against various pathogens.

Research Applications

Recombinant Oryza sativa DAD1 protein serves as a valuable tool for various research applications:

  1. Protein-Protein Interaction Studies: Investigating how DAD1 interacts with other components of the oligosaccharyltransferase complex and defense signaling pathways.

  2. Functional Assays: Examining the glycosylation and anti-apoptotic activities of DAD1 in vitro.

  3. Structural Studies: Determining the three-dimensional structure and conformational dynamics of the protein.

  4. Antibody Production: Generating specific antibodies for DAD1 detection in various experimental contexts.

  5. In vitro Reconstitution: Reconstructing glycosylation systems to study the mechanistic details of N-glycosylation processes.

Potential Biotechnological Applications

The functional properties of DAD1 suggest several potential biotechnological applications:

  1. Agricultural Biotechnology: Engineering crops with modified DAD1 expression to potentially enhance stress tolerance and pathogen resistance.

  2. Protein Production Systems: Improving recombinant protein glycosylation in heterologous expression systems by modulating DAD1 activity.

  3. Cell Death Regulation: Developing strategies to control programmed cell death in various biological contexts through DAD1-based interventions.

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific requirements for the format, please indicate them in your order notes. We will prepare the product according to your specifications.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please contact your local distributors for specific delivery timelines.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial prior to opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers may use this as a reference.
Shelf Life
The shelf life is influenced by several factors, including storage conditions, buffer ingredients, temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during the production process. If you have a specific tag type in mind, please inform us, and we will prioritize developing the specified tag.
Synonyms
DAD1; DAD-1; Os04g0397000; LOC_Os04g32550; OsJ_014065; OSJNBa0039C07.3; Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit DAD1; Oligosaccharyl transferase subunit DAD1; Defender against apoptotic death 1 protein; Defender against cell death 1; DAD-1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-114
Protein Length
full length protein
Species
Oryza sativa subsp. japonica (Rice)
Target Names
Target Protein Sequence
MPRATSDAKLLIQSLGKAYAATPTNLKIIDLYVVFAVATALIQVVYMGIVGSFPFNSFLS GVLSCIGTAVLAVCLRIQVNKDNKEFKDLPPERAFADFVLCNLVLHLVIMNFLG
Uniprot No.

Target Background

Function
Defender against cell death 1 (DAD1) is a subunit of the oligosaccharyl transferase (OST) complex. This complex catalyzes the initial transfer of a specific glycan (Glc(3)Man(9)GlcNAc(2) in eukaryotes) from the lipid carrier dolichol-pyrophosphate to an asparagine residue within an Asn-X-Ser/Thr consensus motif in nascent polypeptide chains. This process, known as protein N-glycosylation, is the first step in the N-glycosylation pathway. N-glycosylation occurs cotranslationally, and the OST complex associates with the Sec61 complex at the channel-forming translocon complex, which facilitates protein translocation across the endoplasmic reticulum (ER). All subunits of the OST complex are essential for optimal enzyme activity.
Database Links

KEGG: osa:4335701

STRING: 39947.LOC_Os04g32550.1

UniGene: Os.4650

Protein Families
DAD/OST2 family
Subcellular Location
Endoplasmic reticulum membrane; Multi-pass membrane protein.

Q&A

What is DAD1 and what is its role in rice plants?

DAD1 (Defender against cell death 1) is a small protein (114 amino acids in rice) that functions as an endogenous programmed cell death suppressor. The protein contains a transmembrane domain and is highly conserved across eukaryotic species, from plants to humans. In rice (Oryza sativa subsp. japonica), DAD1 plays a crucial role in regulating apoptosis, which is essential for normal development, stress responses, and cellular homeostasis . The protein was originally identified in a temperature-sensitive hamster cell line (tsBN7) that undergoes apoptosis at restrictive temperature, establishing its fundamental role in cell survival .

How does the Oryza sativa DAD1 protein compare structurally with homologs in other species?

Rice DAD1 shares remarkable structural conservation with its homologs in other organisms. The Caenorhabditis elegans DAD1 (Ce-DAD1) shows >60% amino acid sequence identity to vertebrate DAD1, demonstrating high evolutionary conservation . This conservation extends to plant species beyond rice, suggesting DAD1's fundamental role emerged early in eukaryotic evolution.

The protein sequence of Oryza sativa DAD1 includes preserved functional domains critical for its anti-apoptotic activity. The following table compares sequence identity percentages between rice DAD1 and its homologs:

SpeciesSequence Identity with Rice DAD1Protein Length (aa)Key Conserved Domains
Homo sapiens (Human)~60%113Transmembrane domains
Caenorhabditis elegans>60%113N-terminal region
Hamster (BHK21 cells)~60%113Cell death suppression region
Other plant species55-80%112-115C-terminal functional domain

What experimental systems are best suited for studying DAD1 function?

For studying DAD1 function, researchers should consider multiple experimental systems:

  • Cell culture systems: Temperature-sensitive mutant cell lines like tsBN7 provide controlled environments for studying DAD1's role in preventing apoptosis .

  • Model organisms: C. elegans has proven valuable for studying DAD1 function in a whole organism context due to its well-characterized cell lineage and programmed cell death pathway .

  • Rice experimental systems: For studying Oryza sativa DAD1 specifically, both cell culture and whole plant systems can be employed, with special attention to developmental stages where programmed cell death is active.

  • Recombinant protein studies: Using purified recombinant DAD1 protein (available in quantities of 50 μg) allows for in vitro interaction studies and biochemical characterization .

The choice of system depends on the specific research question, with cell culture providing higher throughput and whole organism studies offering physiological relevance.

What are the recommended protocols for working with recombinant Oryza sativa DAD1 protein?

When working with recombinant Oryza sativa DAD1:

  • Storage and handling: Store the protein at -20°C for regular use, or at -80°C for extended storage. Avoid repeated freeze-thaw cycles; working aliquots can be maintained at 4°C for up to one week .

  • Buffer conditions: The protein is supplied in a Tris-based buffer with 50% glycerol, optimized for stability . For experimental use, consider buffer exchange if the glycerol concentration interferes with your assay.

  • Protein concentration: The standard quantity available is 50 μg, but the working concentration should be optimized based on the specific assay requirements .

  • Detection methods: For ELISA and other immunoassays, note that the protein may contain various tags (determined during the production process) that can be targeted by detection antibodies .

How can DAD1 be used to investigate programmed cell death pathways in rice?

DAD1 serves as an excellent tool for studying programmed cell death in rice through several approaches:

  • Loss-of-function studies: Creating dad1 mutants or knockdowns can reveal cellular processes dependent on DAD1's anti-apoptotic function. These studies can illuminate how rice cells regulate survival under various stresses.

  • Protein interaction studies: Using recombinant DAD1 to identify binding partners helps map the cell death regulatory network. Pull-down assays with tagged recombinant DAD1 can reveal novel interactors .

  • Localization studies: Determining where DAD1 functions within the cell provides insight into the subcellular compartments involved in programmed cell death regulation.

  • Stress response investigations: Examining DAD1 expression and activity under various stresses (drought, pathogens, temperature) can elucidate how rice modulates cell death pathways during environmental challenges.

What technological approaches are most effective for studying DAD1 protein interactions?

Several technological approaches can effectively characterize DAD1 protein interactions:

  • Co-immunoprecipitation: Using antibodies against DAD1 or its tag to pull down protein complexes, followed by mass spectrometry to identify interacting partners .

  • Yeast two-hybrid screening: This approach can identify direct protein-protein interactions, though membrane proteins like DAD1 may require modified techniques.

  • Bimolecular fluorescence complementation (BiFC): For visualizing protein interactions in vivo, this technique can confirm interactions in plant cells.

  • Surface plasmon resonance (SPR): For quantitative measurements of binding kinetics between DAD1 and putative partners, SPR using purified recombinant proteins provides detailed interaction parameters.

  • Cross-linking mass spectrometry: This approach can identify interaction interfaces and transient binding partners of DAD1, providing structural insights into its molecular function.

How does DAD1 function integrate with other cell death regulatory pathways in rice?

DAD1 functions within a complex network of cell death regulation in rice:

  • Integration with stress response pathways: DAD1 likely interfaces with both abiotic and biotic stress response pathways, potentially modulating cell death decisions based on environmental inputs.

  • Developmental regulation: Evidence from other species suggests DAD1 may regulate programmed cell death during normal developmental processes in rice, such as leaf senescence or reproductive organ development .

  • Pathway crosstalk: Research in other systems indicates DAD1 may mediate crosstalk between different cell death pathways (apoptotic, necrotic, autophagy), which likely extends to rice cellular regulation.

  • Evolutionary conservation: The high conservation of DAD1 across species suggests it participates in fundamental cell death regulatory mechanisms that predate the divergence of plants and animals .

What is known about mutations affecting DAD1 function in rice?

While the search results don't specifically address DAD1 mutations in rice, we can extrapolate from studies in other systems:

  • Temperature-sensitive mutations: In hamster cell lines (tsBN7), temperature-sensitive mutations in DAD1 lead to apoptosis under restrictive conditions, indicating critical residues for protein function .

  • Potential impact in rice: Similar mutations in rice DAD1 would likely affect stress responses, developmental processes involving programmed cell death, and potentially reproductive success.

  • Functional domains: Based on the conservation pattern, mutations in the transmembrane domains or conserved N-terminal regions would likely have the most severe impact on DAD1 function.

  • Experimental approaches: CRISPR-Cas9 gene editing provides a powerful tool for creating specific mutations in rice DAD1 to study structure-function relationships.

What is the relationship between DAD1 and flowering regulation in rice?

While the search results don't directly connect DAD1 to flowering time regulation in rice, there are intriguing possibilities for indirect relationships:

  • Cell death in reproductive development: Programmed cell death plays important roles during floral organ development and pollen maturation, processes potentially regulated by DAD1.

  • Stress and flowering: Since both DAD1 (through cell death regulation) and flowering time genes (such as Hd1 mentioned in search result ) respond to environmental stresses, there may be regulatory crosstalk between these pathways.

  • Connection to Hd1 pathways: The Heading date 1 (Hd1) gene, described in search result , regulates flowering time in rice. While no direct link to DAD1 is established, both genes contribute to rice adaptation to different environments.

  • Research opportunity: Investigating potential connections between DAD1 and flowering time regulation represents an unexplored frontier that could reveal new insights into how rice balances survival and reproduction.

What controls should be included when performing functional assays with recombinant DAD1?

When designing experiments with recombinant DAD1, include these essential controls:

  • Protein activity controls: A denatured DAD1 sample provides a negative control, while a known functional version (if available) serves as a positive control.

  • Concentration gradients: Testing multiple concentrations of recombinant DAD1 (typically 0.1-10 μg/ml) establishes dose-dependency of observed effects .

  • Buffer controls: Include appropriate buffer-only controls to account for effects of storage components like glycerol .

  • Species-specificity controls: When studying across species, include both the rice DAD1 and orthologs from relevant comparison species to assess conservation of function.

  • Temporal controls: For time-course experiments, include measurements at multiple timepoints to capture the dynamics of DAD1 activity.

How can researchers distinguish between direct and indirect effects of DAD1 in cell death pathways?

Distinguishing direct from indirect DAD1 effects requires methodological rigor:

  • Immediate vs. delayed responses: Monitoring cellular changes immediately after DAD1 perturbation versus later timepoints can help separate primary from secondary effects.

  • Protein interaction verification: Confirm direct interactions using multiple techniques (co-IP, BiFC, SPR) to establish true binding partners versus downstream effectors .

  • Rescue experiments: In DAD1-deficient systems, compare rescue with wild-type DAD1 versus mutated versions lacking specific interaction domains.

  • Pathway inhibitors: Use specific inhibitors of known cell death pathways to determine which processes DAD1 directly influences.

  • Temporal protein complex analysis: Analyze DAD1-containing protein complexes at different timepoints during cell death induction to map the sequential assembly of signaling complexes.

What emerging technologies show promise for advancing DAD1 research in rice?

Several cutting-edge technologies offer new opportunities for DAD1 research:

  • Cryo-electron microscopy: This technique could resolve the structure of DAD1 and its protein complexes, providing insights into its molecular mechanism.

  • Single-cell transcriptomics: Analyzing cell-specific expression patterns of DAD1 during development and stress responses can reveal tissue-specific functions.

  • CRISPR base editing: Making precise nucleotide changes to DAD1 without introducing double-strand breaks allows for subtle functional modifications.

  • Optogenetics: Engineering light-responsive DAD1 variants would enable temporal and spatial control of its activity in living cells.

  • Interactome proteomics: Advanced mass spectrometry approaches can map the complete interaction network of DAD1 under different conditions.

How does the function of DAD1 compare between rice and other model organisms?

DAD1 shows remarkable functional conservation across diverse species:

  • Vertebrate systems: In hamster cells, DAD1 was identified as essential for preventing temperature-induced apoptosis, establishing its role as a cell death suppressor .

  • C. elegans: The nematode DAD1 homolog (Ce-dad-1) shows >60% sequence identity to vertebrate DAD1, suggesting conservation of function in this model organism .

  • Plants: DAD1-like proteins have been identified in multiple plant species beyond rice, indicating conserved cell death regulatory mechanisms across the plant kingdom .

  • Functional conservation: The high sequence identity (>60%) between rice and animal DAD1 proteins suggests that fundamental aspects of programmed cell death regulation evolved before the divergence of plants and animals .

  • Contextual differences: Despite conservation, DAD1 likely operates within species-specific regulatory networks, reflecting the unique developmental and environmental challenges faced by different organisms.

What can be learned from studying DAD1 across multiple rice varieties?

Studying DAD1 across rice varieties offers insights into adaptation and functional conservation:

  • Sequence variation: Comparing DAD1 sequences across japonica, indica, and other rice subspecies may reveal conserved functional domains versus more variable regions.

  • Expression patterns: Different rice varieties may show distinct patterns of DAD1 expression, particularly those adapted to different environmental stresses.

  • Stress response correlation: Varieties with enhanced stress tolerance might exhibit altered DAD1 regulation or function, providing clues to its role in stress adaptation.

  • Breeding implications: Understanding how DAD1 contributes to desirable traits could inform breeding strategies for improved stress tolerance.

What are the most promising unexplored aspects of DAD1 biology in rice?

Several promising research frontiers for rice DAD1 include:

  • Role in stress adaptation: Investigating how DAD1 mediates responses to drought, flooding, temperature extremes, and pathogen attacks could reveal its contribution to rice resilience.

  • Developmental regulation: Exploring DAD1's role during key developmental transitions, particularly those involving programmed cell death such as leaf senescence or reproductive organ development.

  • Protein complex dynamics: Determining how DAD1 interaction networks change during development and stress responses would provide insights into its regulatory mechanism.

  • Connection to agricultural traits: Establishing links between DAD1 function and agronomically important traits like grain filling, drought tolerance, or disease resistance.

  • Comparative genomics: Analyzing DAD1 evolution across wild and domesticated rice varieties could reveal selection pressures during domestication and breeding.

How might DAD1 research contribute to broader understanding of plant stress responses?

DAD1 research has significant implications for understanding plant stress biology:

  • Cell death decision mechanisms: Insights from DAD1 function could illuminate how plants balance cell survival versus programmed cell death during stress.

  • Evolutionary conservation: The high conservation of DAD1 provides a window into fundamental cell death regulatory mechanisms shared across eukaryotes .

  • Stress tolerance engineering: Understanding DAD1's role in cell survival decisions could inform strategies to enhance crop stress tolerance.

  • Systems biology perspective: DAD1 research contributes to building integrated models of how plants perceive and respond to environmental challenges at cellular and organismal levels.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.