Recombinant Oryza sativa subsp. japonica Derlin-1 (DER1)

Shipped with Ice Packs
In Stock

Description

Biological Function and Mechanism

DER1 is a central component of the ERAD machinery, facilitating retrotranslocation of misfolded proteins from the ER lumen to the cytosol for proteasomal degradation . Key functional insights include:

  • ER Stress Response: OsDER1 expression is upregulated under ER stress (e.g., tunicamycin treatment), linking it to the unfolded protein response (UPR) .

  • Complex Formation: OsDER1 interacts with OsHRD1, OsHRD3, and OsCDC48, forming a canonical ERAD complex . It also associates with signal peptide peptidase (SPP), suggesting involvement in alternative ERAD pathways .

  • Seed Development: Suppression of OsDER1 in rice results in floury, shrunken seeds due to disrupted protein quality control, highlighting its role in seed maturation .

Genetic Manipulation and Phenotypic Effects

  • Overexpression/Suppression: Both overexpression and RNAi suppression of OsDER1 induce ER stress hypersensitivity and UPR activation in transgenic rice .

  • Ubiquitination: Elevated polyubiquitinated protein levels in transgenic lines indicate impaired ERAD efficiency .

Applications in Research

Recombinant DER1 is utilized to:

  1. Study Plant ERAD Pathways: Investigate retrotranslocation mechanisms and stress adaptation .

  2. Engineer Stress-Tolerant Crops: Modulating DER1 expression could enhance resilience to abiotic stresses (e.g., drought, heat) .

  3. Develop Biotechnological Tools: Commercial vendors offer DER1 as a reagent for ELISA, protein interaction assays, and structural studies .

Future Directions

Current gaps include elucidating DER1’s role in pathogen response and resolving its 3D structure to inform drug design. Advances in CRISPR-Cas9 could further clarify its regulatory networks in crop species .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format that we have in stock. However, if you have specific requirements for the format, please indicate them in your order. We will prepare the product according to your request.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please contact your local distributors for specific delivery time information.
Note: All of our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly prior to opening to ensure the contents are settled at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers can use this as a reference.
Shelf Life
The shelf life is influenced by various factors such as storage conditions, buffer composition, storage temperature, and the protein's inherent stability.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The shelf life of the lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
DER1; Os05g0187800; LOC_Os05g09550; B1007D10.4; OJ1097_A12.10; OsJ_17392; Derlin-1; 18 kDa cold-induced protein; DER1-like protein 1; OsDerlin 1-1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-242
Protein Length
full length protein
Species
Oryza sativa subsp. japonica (Rice)
Target Names
DER1
Target Protein Sequence
MSSPAEYYNSLPPISKAYGTLCFFATVLCQLQILNPPFLALYYPFVFKKFQIWRLFTSFF FLGKFSINFGIRLLMIARYGVQLEKGAFEKRTADFLWMMIFGAISLLALSAIPFLDIYFL GVPMVSMLLYVWSREYPNSQISMYGLVQLRSFYLPWAMLGLDVIFGSEILPGLLGILVGH TYYFLSVLHPLATGKNYLKTPMWVHKIVARFRIGVQANAPVRPAAANTGSGAFRGRSYRL SQ
Uniprot No.

Target Background

Function
Derlin-1 (DER1) may play a role in the degradation process of specific misfolded endoplasmic reticulum (ER) luminal proteins.
Database Links

KEGG: osa:4338013

STRING: 39947.LOC_Os05g09550.1

UniGene: Os.148

Protein Families
Derlin family
Subcellular Location
Endoplasmic reticulum membrane; Multi-pass membrane protein.
Tissue Specificity
Seedling shoots and roots.

Q&A

What is Oryza sativa subsp. japonica Derlin-1 and what cellular functions does it serve?

Oryza sativa subsp. japonica Derlin-1 (DER1) is a 242-amino acid protein involved in endoplasmic reticulum-associated degradation (ERAD) pathways in rice. It functions primarily in protein quality control mechanisms, helping to recognize and process misfolded proteins within the ER membrane. The protein is also known by alternative names including "18 kDa cold-induced protein," "DER1-like protein 1," and "OsDerlin 1-1," suggesting its role in cold stress responses . As an integral membrane protein, DER1 plays a crucial role in maintaining cellular proteostasis during environmental stress conditions, particularly during temperature fluctuations that can impact protein folding efficiency. Research indicates that DER1 expression is upregulated during cold stress, suggesting its importance in adaptation mechanisms to environmental challenges.

How should researchers properly store and handle recombinant DER1 protein?

For optimal stability and activity of recombinant DER1 protein, researchers should follow these methodological guidelines:

  • Short-term storage: Store working aliquots at 4°C for up to one week .

  • Long-term storage: Store at -20°C or -80°C in a buffer containing 50% glycerol to prevent freeze-thaw damage .

  • Aliquoting strategy: Upon receipt, centrifuge the vial briefly to bring contents to the bottom, then reconstitute in deionized sterile water to a concentration of 0.1-1.0 mg/mL .

  • Freeze-thaw cycles: Avoid repeated freeze-thaw cycles as they significantly reduce protein activity. Create single-use aliquots when possible .

  • Buffer conditions: For reconstitution, use Tris/PBS-based buffer with 6% trehalose at pH 8.0 to maintain optimal protein structure .

When preparing working solutions, adding glycerol to a final concentration of 5-50% is recommended, with 50% being optimal for extended storage periods . This approach minimizes protein denaturation and aggregation while preserving functional activity for experimental applications.

What experimental design approaches are most appropriate for studies involving recombinant DER1?

When designing experiments with recombinant DER1, researchers should implement true experimental research designs with appropriate controls to establish causality and ensure valid results. The following methodological framework is recommended:

  • Variable identification:

    • Independent variables: Typically treatment conditions (e.g., temperature, stress inducers, interacting proteins)

    • Dependent variables: Measures of DER1 function or activity

    • Control variables: Factors that must be standardized across experimental conditions

  • Randomization: Implement proper randomization to distribute unknown variables equally across experimental groups, reducing systematic bias .

  • Control group implementation: Include appropriate negative controls (e.g., mock treatments) and positive controls (e.g., known DER1 inducers) in parallel with experimental treatments .

  • Replication strategy:

    • Technical replicates: Minimum of three per sample to account for measurement variability

    • Biological replicates: Minimum of three independent protein preparations to account for batch-to-batch variation

This structured approach is critical for establishing causal relationships between experimental manipulations and observed changes in DER1 function or interactions . When reporting results, clearly document all experimental variables and controls to enable replication by other researchers.

How can researchers verify the authenticity and activity of recombinant DER1 protein?

Verifying both the authenticity and functional activity of recombinant DER1 requires a multi-method approach:

Authenticity verification:

  • SDS-PAGE analysis: Confirm protein size (approximately 26-28 kDa for His-tagged DER1) and purity (should exceed 90%) .

  • Western blot: Using anti-His tag antibodies for tagged versions or specific anti-DER1 antibodies.

  • Mass spectrometry: For precise molecular weight determination and peptide fingerprinting.

  • N-terminal sequencing: To confirm the correct starting sequence of the recombinant protein.

Functional verification:

  • Membrane integration assays: To confirm proper insertion into lipid bilayers.

  • Protein-protein interaction studies: Using pull-down assays to verify interactions with known ERAD pathway components.

  • Complementation assays: Testing ability to rescue DER1-deficient systems.

These complementary approaches provide comprehensive verification of both structural integrity and functional capacity of the recombinant protein, ensuring that experimental observations truly reflect the biological activity of DER1 rather than artifacts from protein production or purification processes.

What controls should be included when studying DER1 function in stress response pathways?

A robust experimental design for studying DER1 in stress response pathways requires comprehensive controls:

Essential experimental controls:

Control TypePurposeImplementation
Negative controlsEstablish baseline responsesUntreated samples, vector-only expressions
Positive controlsValidate assay sensitivityKnown stress inducers (e.g., tunicamycin for ER stress)
Vehicle controlsAccount for solvent effectsMatching solvent concentrations without active compounds
Time-course controlsMonitor temporal dynamicsSamples collected at multiple timepoints
Genetic controlsConfirm specificityDER1 knockout/knockdown and overexpression lines
Cross-species controlsAssess conservationComplementation with DER1 homologs from other species

Additionally, researchers should implement stress-specific controls. For cold stress studies, include temperature-regulated experiments with non-cold-responsive proteins as comparators. For other stressors, include proteins known to respond to those specific conditions to differentiate general stress responses from DER1-specific functions . This comprehensive control strategy enables researchers to distinguish DER1-specific effects from general cellular responses to experimental manipulations.

How can recombinant DER1 be used to investigate protein quality control mechanisms?

Recombinant DER1 provides a powerful tool for dissecting protein quality control mechanisms through several methodological approaches:

  • Reconstitution experiments: Purified recombinant DER1 can be incorporated into artificial membrane systems along with other ERAD components to reconstitute the protein quality control machinery in vitro. This approach allows researchers to systematically add or remove components to determine their functional significance in the pathway.

  • Substrate processing assays: By combining recombinant DER1 with model misfolded proteins tagged with fluorescent or luminescent reporters, researchers can quantitatively measure substrate processing efficiency under various conditions.

  • Structure-function analysis: Site-directed mutagenesis of recombinant DER1 enables identification of critical residues for function. The complete amino acid sequence available from the search results provides a foundation for designing targeted mutations to disrupt specific protein domains or interaction interfaces .

  • Comparative studies: Using the rice DER1 sequence as a reference point, researchers can perform comparative analyses with DER1 homologs from other plant species to identify conserved and divergent features related to environmental adaptation.

These approaches collectively enable researchers to move beyond correlative observations and establish mechanistic understanding of DER1's role in protein quality control pathways, particularly in the context of environmental stress responses.

What methodological approaches can address contradictory findings in DER1 research?

When faced with contradictory findings regarding DER1 function or interactions, researchers should implement a systematic approach to resolve discrepancies:

  • Experimental design evaluation: Review the experimental designs of contradictory studies using frameworks from experimental design literature. True experimental designs with proper controls and randomization provide stronger evidence than flawed experimental designs such as one-shot case studies or comparisons with uncontrolled group membership .

  • Multi-method validation: Employ complementary methodologies to test the same hypothesis:

    • In vitro biochemical assays

    • In vivo functional studies

    • Structural analyses

    • Computational modeling

  • Systematic variation of conditions: Methodically vary experimental parameters that might explain differences:

    • Protein concentration ranges

    • Buffer compositions

    • Temperature conditions

    • Plant developmental stages

    • Stress exposure durations

  • Meta-analysis approach: When multiple studies report conflicting results, conduct a formal meta-analysis to identify patterns and variables that might explain discrepancies.

  • Collaborative verification: Establish collaborations between labs reporting contradictory findings to perform side-by-side experiments with standardized protocols and shared materials.

This systematic approach acknowledges that contradictions often arise from methodological differences or context-dependent functions rather than inherent irreproducibility, leading to a more nuanced understanding of DER1 biology.

What are common experimental artifacts when working with recombinant DER1 and how can they be mitigated?

Working with recombinant membrane proteins like DER1 presents several methodological challenges that can lead to experimental artifacts:

Challenge 1: Protein aggregation and misfolding

  • Solution: Optimize expression conditions by using lower induction temperatures (16-18°C) and inducer concentrations. Include stabilizing agents such as glycerol (6-50%) in purification and storage buffers .

Challenge 2: Inadequate membrane integration

  • Solution: Validate membrane insertion using protease protection assays and proper detergent selection for extraction and purification.

Challenge 3: Tag interference with function

  • Solution: Compare N-terminal and C-terminal tagged versions, or use cleavable tags. For DER1, an N-terminal His tag has been successfully used for expression in E. coli systems .

Challenge 4: Non-specific binding in interaction studies

  • Solution: Include stringent controls including tag-only proteins and irrelevant membrane proteins of similar size and hydrophobicity.

Challenge 5: Batch-to-batch variability

  • Solution: Implement standardized expression and purification protocols with quality control checkpoints. For lyophilized DER1 powder, reconstitution procedures should be strictly standardized .

Challenge 6: Buffer incompatibility with functional assays

  • Solution: Test buffer exchange methods that maintain protein stability while ensuring compatibility with downstream applications.

By anticipating and systematically addressing these methodological challenges, researchers can avoid misinterpreting artifacts as biologically relevant phenomena and ensure reproducibility in DER1 research.

How can researchers distinguish between direct and indirect effects in DER1 functional studies?

Distinguishing direct from indirect effects in DER1 functional studies requires methodological rigor and careful experimental design:

  • In vitro reconstitution approaches:

    • Using purified components to demonstrate direct physical interactions

    • Conducting kinetic analyses to establish order-of-events in multi-component systems

    • Implementing defined minimal systems to eliminate confounding factors

  • Structure-guided mutational analysis:

    • Creating targeted mutations that specifically disrupt particular interaction interfaces

    • Developing interaction-deficient but properly folded DER1 variants

    • Using the known 242-amino acid sequence to guide rational mutagenesis approaches

  • Proximity-based methods:

    • Implementing time-resolved crosslinking studies

    • Using FRET/BRET approaches with appropriate controls

    • Applying proximity labeling techniques with spatial resolution

  • Temporal resolution strategies:

    • Conducting time-course experiments with high temporal resolution

    • Using rapidly inducible systems to capture immediate responses

    • Implementing pulse-chase approaches to track dynamic processes

  • Computational validation:

    • Modeling potential direct interactions based on structural predictions

    • Using network analysis to identify likely direct vs. indirect connections

    • Applying Bayesian approaches to estimate probability of direct causality

This multi-faceted approach enables researchers to build a weight-of-evidence case for direct effects while systematically ruling out indirect mechanisms that might otherwise confound interpretation of experimental results.

What emerging technologies are poised to advance DER1 research in plants?

Several cutting-edge methodological approaches are particularly promising for advancing DER1 research in plants:

  • CRISPR-Cas9 genome editing:

    • Precise modification of endogenous DER1 genes to create functional variants

    • Introduction of reporter tags at endogenous loci for visualizing native expression patterns

    • Generation of conditional knockout systems for temporal control of DER1 expression

  • Cryo-electron microscopy:

    • Structural determination of DER1 in its native membrane environment

    • Visualization of DER1-containing protein complexes during substrate processing

    • Comparative structural analysis of DER1 conformations under different stress conditions

  • Single-molecule tracking:

    • Monitoring DER1 dynamics in living plant cells

    • Quantifying stoichiometry of DER1-containing complexes

    • Measuring residence times of DER1 interactions with partner proteins

  • Proteomics and interactomics:

    • Quantitative interaction proteomics to identify condition-specific DER1 partners

    • Proximity labeling approaches to capture transient interactions

    • Cross-linking mass spectrometry to define interaction interfaces

  • Synthetic biology approaches:

    • Engineering minimal ERAD systems incorporating DER1

    • Creating optogenetic tools for spatiotemporal control of DER1 function

    • Developing biosensors to monitor DER1 activity in real-time

These emerging technologies offer unprecedented resolution for studying DER1 biology, potentially resolving longstanding questions about its precise mechanisms of action in plant stress responses and protein quality control pathways.

How might AI and computational tools impact experimental design in DER1 research?

The integration of AI and computational tools is transforming experimental design in protein research, including studies of DER1:

  • AI-assisted experimental design:

    • Optimization of experimental parameters using machine learning algorithms

    • Identification of key variables for factorial experimental designs

    • Prediction of potential confounding factors requiring control

  • Bias detection and mitigation:

    • Identification of potential sources of bias in experimental protocols

    • Recommendation of appropriate randomization strategies

    • Analysis of researcher behavior patterns that might influence results

  • Data analysis and interpretation:

    • Pattern recognition in complex datasets

    • Identification of unexpected correlations

    • Extraction of meaningful signals from noisy experimental data

  • Literature synthesis:

    • Comprehensive analysis of published DER1 research

    • Identification of knowledge gaps and contradictions

    • Suggestion of experiments to resolve conflicting findings

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.