Recombinant Oryza sativa subsp. japonica E3 ubiquitin-protein ligase EL5 (EL5.1)

Shipped with Ice Packs
In Stock

Description

Overview

Recombinant Oryza sativa subsp. japonica E3 ubiquitin-protein ligase EL5 (EL5.1) is a protein that functions as an E3 ubiquitin ligase in rice (Oryza sativa subsp. japonica) . E3 ubiquitin ligases are enzymes that facilitate the transfer of ubiquitin to target proteins, a process known as ubiquitination . Ubiquitination plays a crucial role in various cellular processes, including protein degradation, signal transduction, and DNA repair . EL5.1, in particular, is involved in root development in rice plants and interacts with E2 ubiquitin-conjugating enzymes UBC5A and UBC5B to mediate the ubiquitination of target proteins .

Gene Information and Synonyms

The gene name for Recombinant Oryza sativa subsp. japonica E3 ubiquitin-protein ligase EL5 (EL5.1) is EL5.1 . Synonyms for EL5.1 include EL5, Os02g0559800, LOC_Os02g35329, P0435E12.16, EL5.2, Os02g0560200, LOC_Os02g35347, P0435E12.20, EL5.3, Os02g0560600, LOC_Os02g35365, P0435E12.24, EL5.4, Os02g0561000, LOC_Os02g35383, P0435E12.28, EL5.5, Os02g0561400, and LOC_Os02g35401 .

Table 1: Gene and Protein Information

AttributeDescription
Gene NameEL5.1
SynonymsEL5; Os02g0559800; LOC_Os02g35329; P0435E12.16; EL5.2; Os02g0560200; LOC_Os02g35347; P0435E12.20; EL5.3; Os02g0560600; LOC_Os02g35365; P0435E12.24; EL5.4; Os02g0561000; LOC_Os02g35383; EL5.5
UniProt IDQ9LRB7
Protein NameE3 ubiquitin-protein ligase EL5
Synonym Protein NamesProtein ELICITOR 5; RING-type E3 ubiquitin transferase EL5Curated
UniProt Secondary Accession #Q0E0C5

Function and Mechanism

EL5.1 functions as an E3 ubiquitin-protein ligase, which means it plays a critical role in the ubiquitination pathway . This pathway involves the sequential action of three enzymes: E1 (ubiquitin-activating enzyme), E2 (ubiquitin-conjugating enzyme), and E3 (ubiquitin ligase) . E3 ligases like EL5.1 confer specificity to the process by recognizing and binding to specific substrate proteins, facilitating the transfer of ubiquitin from the E2 enzyme to the substrate .

EL5.1 has been shown to interact with E2 ubiquitin-conjugating enzymes UBC5A and UBC5B . This interaction is essential for its function in ubiquitinating target proteins. Specifically, EL5.1 mediates 'Lys-48'-linked polyubiquitination in vitro, which typically targets proteins for degradation by the proteasome .

The protein is involved in root development and is required for maintaining cell viability after the initiation of root primordial formation . It may mediate the degradation of cytotoxic proteins produced in root cells following the actions of auxin, cytokinin, and jasmonic acid .

Role in Protein Structure-Function Continuum

The function of EL5.1 aligns with the protein structure-function continuum model, where a protein's function is related to its dynamic conformational ensemble . This model emphasizes that a protein exists in multiple forms (proteoforms) due to factors such as post-translational modifications and intrinsically disordered regions . The disorder is critical for understanding protein-protein interactions in many regulatory processes .

Related Products and Research Tools

Recombinant EL5.1 is available from multiple suppliers for research purposes . These suppliers often offer the protein with a His-tag for purification and detection . Additionally, antibodies against EL5.1 are available for protein detection and quantification .

Table 2: Available Forms and Sources

SourceTagSupplier
E. coliHis-TagCreative BioMart
E. coliN-terminal 10xHis-tagged and C-terminal Myc-taggedGene Biosystems
YeastN/ACUSABIO
E. coliN/ACUSABIO
E. coliAvi-tag BiotinylatedCUSABIO
BaculovirusN/ACUSABIO
Mammalian cellN/ACUSABIO

These products are intended for research use only and not for clinical applications .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a reference.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
EL5.1; EL5; Os02g0559800; LOC_Os02g35329; P0435E12.16; EL5.2; Os02g0560200; LOC_Os02g35347; P0435E12.20; EL5.3; Os02g0560600; LOC_Os02g35365; P0435E12.24; EL5.4; Os02g0561000; LOC_Os02g35383; P0435E12.28; EL5.5; Os02g0561400; LOC_Os02g35401; P0435E12.32; EL5.6; Os02g0561800; LOC_Os02g35429; P0435E12.37; E3 ubiquitin-protein ligase EL5; Protein ELICITOR 5; RING-type E3 ubiquitin transferase EL5
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-325
Protein Length
full length protein
Species
Oryza sativa subsp. japonica (Rice)
Target Names
EL5.1
Target Protein Sequence
MVRGVEQGGPAMDESSSSSSPSPVSAPAGQAAMTAGGIATVAAVLIVFAALTLAFVLLQC YCDERRRAVTTTSTSGRGRRPRPRRRSGSGGDGGTGGGVDPEVLRSLPVTVYSRSTAAAA AKEEEEEDDDGVECAVCLAELEDGEEARFLPRCGHGFHAECVDMWLGSHSTCPLCRLTVV VPPPPLPPVPPEPPASYTVSLPASVLLGLSDHGAGAVTMTAEGRSTLVIEIPESAASTTP RDAAARSSPSLARLRSLRRLWSFGRQGAAGSTSSCSCATGGDNDDGDVEHGVSVTVAIRA VEAATPARPPEAEAGARTAAAHVRN
Uniprot No.

Target Background

Function
This protein functions as an E3 ubiquitin-protein ligase, collaborating with E2 ubiquitin conjugating enzymes UBC5A and UBC5B. It plays a role in root development and is essential for maintaining cell viability after root primordial formation. It may mediate the degradation of cytotoxic proteins generated in root cells following auxin, cytokinin, and jasmonic acid activity. In vitro, it mediates Lys-48-linked polyubiquitination of MBP.
Database Links
Subcellular Location
Cell membrane; Single-pass membrane protein.

Q&A

What is E3 ubiquitin-protein ligase EL5 and what is its significance in rice?

E3 ubiquitin-protein ligase EL5 is a membrane-anchored ubiquitin ligase characterized by a transmembrane domain at the N-terminal and a RING-H2 finger domain (RFD). It plays a crucial role as an anti-cell death enzyme during root development in rice. The protein is also known as Protein ELICITOR 5, and its transcript is upregulated by chitin elicitor, suggesting involvement in plant defense responses . EL5 maintains cell viability after the initiation of root primordial formation, making it essential for proper root development and architecture in rice .

What are the key structural components of EL5 protein?

EL5 contains several key structural components that are essential for its function:

  • Transmembrane domain at the N-terminal region

  • RING-H2 finger domain (RFD, amino acid residues 129-181) that exhibits E3 ubiquitin ligase activity

  • C-terminal region that contributes to its regulatory function

The three-dimensional structure of the EL5-RFD has been determined by NMR spectroscopy, representing the first plant E3 with a resolved structure . The RFD serves as a binding domain for ubiquitin-conjugating enzymes (E2), and specific amino acid residues within this domain are critical for the interaction with E2 enzymes such as OsUBC5b .

How does EL5 function as an anti-cell death ubiquitin ligase during root development?

EL5 appears to play a critical role in preventing programmed cell death in developing root tissues. Studies using transgenic rice plants expressing mutant EL5 proteins with impaired E3 activity demonstrate this function:

EL5 VariantE3 Activity LevelRoot PhenotypeCellular Effects
EL5C153AInactiveRootlessCell death in root primordia
EL5W165AInactiveRootlessCell death in root primordia
EL5V162AModerately impairedShort crown rootsNecrotic lateral roots
Wild-typeNormalNormalNormal cell viability

The dominant-negative phenotype is specifically observed in root meristems where EL5 is expressed and cannot be recovered by exogenous auxin application . This suggests that EL5 might be responsible for mediating the degradation of cytotoxic proteins produced in root cells after the actions of phytohormones . Without functional EL5, these cytotoxic proteins accumulate and trigger cell death in developing root tissues.

What is the mechanism of polyubiquitination catalyzed by EL5?

The EL5-RFD catalyzes polyubiquitination via the Lys48 residue of ubiquitin . This specific linkage type is particularly significant because Lys48-linked polyubiquitin chains typically target substrate proteins for degradation by the 26S proteasome. The polyubiquitination process involves:

  • Initial activation of ubiquitin by E1 (ubiquitin-activating enzyme)

  • Transfer of ubiquitin to E2 (ubiquitin-conjugating enzyme, such as OsUBC5b)

  • EL5 (E3) facilitating the transfer of ubiquitin from E2 to the substrate protein

  • Formation of Lys48-linked polyubiquitin chains on the substrate

This mechanism allows EL5 to target specific proteins for degradation, potentially including cytotoxic proteins that would otherwise trigger cell death in developing root tissues .

How do mutations in the EL5 RING-H2 finger domain affect its interaction with E2 enzymes?

The interaction between EL5-RFD and E2 enzymes has been extensively studied using NMR titration experiments and in vitro ubiquitination assays. Key amino acid residues involved in this interaction have been identified:

ResidueRole in E2 BindingEffect of Mutation on E3 Activity
C153Zinc coordinationComplete loss of E3 activity
W165Direct interaction with E2Complete loss of E3 activity
V162Supporting interaction surfaceModerate impairment of E3 activity

Mutations in these residues result in varying degrees of decreased E3 activity depending on their contribution to the interaction with E2 . Plants expressing EL5C153A and EL5W165A (inactive E3) show a rootless phenotype with cell death in root primordia, while those expressing EL5V162A (moderately impaired E3) form short crown roots with necrotic lateral roots . These findings demonstrate the critical importance of the EL5-E2 interaction for proper root development.

How can researchers purify and handle recombinant EL5 protein for in vitro studies?

For optimal handling of recombinant EL5 protein:

  • Storage conditions: Store in Tris-based buffer with 50% glycerol at -20°C for regular storage or -80°C for extended storage .

  • Working conditions: Working aliquots can be maintained at 4°C for up to one week .

  • Stability considerations: Avoid repeated freezing and thawing as this may compromise protein activity .

  • Buffer composition: The recommended storage buffer is a Tris-based buffer, optimized for this specific protein .

The full-length protein has 325 amino acid residues with the amino acid sequence provided in the UniProt database (Q9LRB7) . When working with EL5, it's important to consider its membrane-associated nature due to the N-terminal transmembrane domain.

What is the optimal protocol for measuring EL5 ubiquitin ligase activity in vitro?

An in vitro ubiquitination assay is essential for measuring EL5 E3 ligase activity. The recommended protocol includes:

ComponentConcentrationNotes
Recombinant EL5-RFD1-5 μMFull-length protein can be used but may require detergent
E1 enzyme0.1-0.5 μMCommercial ubiquitin-activating enzyme
E2 enzyme (OsUBC5b)1-10 μMRice-specific E2 known to work with EL5
Ubiquitin50-100 μMWild-type or mutant (K48R to test linkage specificity)
ATP2-5 mMEnergy source for the reaction
MgCl₂5-10 mMCofactor for ATP utilization
Buffer-Typically Tris-HCl pH 7.5 with DTT

The reaction is typically incubated at 30°C for 1-2 hours and then analyzed by SDS-PAGE followed by Western blotting with anti-ubiquitin antibodies. The formation of polyubiquitin chains indicates E3 ligase activity . For studying Lys48-specific polyubiquitination, ubiquitin mutants where all lysines except Lys48 are mutated to arginine can be used.

What approaches are effective for generating and analyzing EL5 mutants in planta?

To study EL5 function through mutant analysis in plants:

  • Construct design: Create expression vectors containing mutated versions of EL5, such as:

    • EL5C153A and EL5W165A (inactive E3)

    • EL5V162A (moderately impaired E3)

    • Deletion mutants lacking the transmembrane domain or C-terminal region

  • Transformation method: Agrobacterium-mediated transformation is typically used for rice transformation .

  • Expression system options:

    • Constitutive expression using promoters like CaMV 35S

    • Inducible expression systems to control timing of expression

    • Tissue-specific promoters to target expression to roots

  • Phenotypic analysis:

    • Examine root development (crown roots and lateral roots)

    • Perform cell viability assays in root tissues

    • Test response to exogenous auxin application

    • Analyze protein accumulation by Western blotting

  • Molecular analysis:

    • Confirm transgene expression by RT-PCR or qRT-PCR

    • Verify protein expression by Western blotting

    • Examine subcellular localization using fluorescent protein fusions

This comprehensive approach allows researchers to dissect the structure-function relationship of EL5 in planta .

How should researchers interpret complex phenotypes in plants with altered EL5 function?

When analyzing phenotypes in plants with altered EL5 function, consider:

  • Specificity of effects:

    • The dominant-negative phenotype of EL5 mutants is specifically observed in root meristems where EL5 is expressed .

    • Effects should be correlated with the level of E3 activity impairment (complete vs. moderate).

  • Developmental timing:

    • Effects on root development occur after the initiation of root primordial formation, suggesting EL5 maintains cell viability rather than initiating root formation .

  • Hormone responses:

    • The phenotype cannot be recovered by exogenous auxin application, indicating EL5 functions downstream or independently of auxin signaling .

  • Cellular effects:

    • Look for evidence of cell death in root primordia and necrosis in lateral roots.

    • Consider using viability stains to quantify cell death in different tissues.

  • Protein accumulation:

    • Monitor accumulation of both the EL5 protein itself and potential substrate proteins.

    • Changes in protein accumulation patterns may indicate direct or indirect effects of altered EL5 function.

What approaches can identify potential substrate proteins targeted by EL5 for ubiquitination?

Identifying EL5 substrates is challenging but critical for understanding its function. Effective approaches include:

  • Comparative proteomics:

    • Compare protein accumulation in wild-type plants versus those expressing inactive EL5.

    • Proteins that accumulate in plants with inactive EL5 are potential substrates.

  • Ubiquitinome analysis:

    • Use mass spectrometry to identify changes in the ubiquitinated proteome when EL5 function is altered.

    • Focus on proteins with reduced Lys48-linked polyubiquitination in EL5 mutants.

  • Protein interaction studies:

    • Yeast two-hybrid screening to identify proteins that interact with EL5.

    • Co-immunoprecipitation followed by mass spectrometry.

    • Proximity-labeling approaches (BioID or APEX2) to identify proteins in close proximity to EL5 in vivo.

  • Candidate approach:

    • Test known pro-apoptotic or cytotoxic proteins as potential EL5 substrates.

    • Focus on proteins involved in programmed cell death pathways in plants.

  • Validation studies:

    • Direct in vitro ubiquitination assays with purified EL5 and candidate substrates.

    • Analysis of substrate protein stability in plants with altered EL5 function.

What are the key knowledge gaps in understanding EL5 function in rice development?

Several critical questions remain about EL5 function:

  • Substrate identification:

    • What are the specific proteins targeted by EL5 for ubiquitination and degradation?

    • How does EL5 recognize its substrates?

  • Mechanistic understanding:

    • What is the precise mechanism by which loss of EL5 function leads to cell death in root primordia?

    • How is EL5 itself degraded in a proteasome-independent manner?

  • Regulation and signaling:

    • How is EL5 activity regulated in response to developmental and environmental cues?

    • What is the relationship between EL5's role in root development and its upregulation by chitin elicitor?

  • Evolutionary conservation:

    • Is EL5 function conserved in other plant species beyond rice?

    • How has the EL5 substrate recognition system evolved?

  • Applied aspects:

    • Can manipulation of EL5 be used to enhance root development in crop plants?

    • Does EL5 function relate to stress tolerance or nutrient acquisition efficiency?

How can emerging technologies advance our understanding of EL5 function?

Emerging technologies offer new opportunities to study EL5:

  • CRISPR-Cas9 genome editing:

    • Generate precise mutations in endogenous EL5 to avoid potential artifacts of overexpression.

    • Create knockouts or knockins of fluorescent tags at the endogenous locus.

  • Advanced imaging techniques:

    • Super-resolution microscopy to visualize EL5 localization at subcellular detail.

    • Live-cell imaging to track dynamic changes in EL5 localization and activity.

    • Multi-color imaging to simultaneously visualize EL5 and potential substrate proteins.

  • Single-cell approaches:

    • Single-cell transcriptomics to examine cell-type specific responses to altered EL5 function.

    • Single-cell proteomics to detect subtle changes in protein abundance.

  • Structural biology:

    • Cryo-electron microscopy to determine the structure of full-length EL5 in membrane.

    • Structural studies of EL5 in complex with E2 and substrate proteins.

  • Systems biology:

    • Multi-omics integration to understand EL5 function in the context of broader cellular networks.

    • Mathematical modeling of ubiquitination dynamics and protein turnover regulated by EL5.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.