Recombinant Oryza sativa subsp. japonica E3 ubiquitin-protein ligase Os03g0188200 (Os03g0188200, LOC_Os03g08920)

Shipped with Ice Packs
In Stock

Description

General Information

Recombinant Oryza sativa subsp. japonica E3 ubiquitin-protein ligase Os03g0188200 (Os03g0188200, LOC_Os03g08920) is a protein in rice (Oryza sativa) that functions as an E3 ubiquitin ligase . E3 ubiquitin ligases are enzymes that play a critical role in the ubiquitination process, which involves attaching ubiquitin proteins to target substrates . This process is essential for regulating various biological functions within cells, including cell signaling, DNA repair, and protein degradation .

Ubiquitination and E3 Ligases

The ubiquitination process is a crucial post-translational modification that affects protein function and stability . It involves a cascade of enzymes:

  • E1 (Ubiquitin-Activating Enzyme): Activates ubiquitin for conjugation and transfers it to an E2 enzyme .

  • E2 (Ubiquitin-Conjugating Enzyme): Interacts with a specific E3 partner and transfers the ubiquitin to the target protein .

  • E3 (Ubiquitin Ligase): Recognizes the target protein and facilitates the transfer of ubiquitin from the E2 enzyme to the substrate . E3 ligases provide specificity in the ubiquitination process, ensuring that ubiquitin is attached to the correct target proteins .

E3 ligases can attach ubiquitin to lysine, serine, threonine, or cysteine residues on target substrates, influencing protein expression levels, cellular localization, and protein interactions . The human genome encodes over 600 putative E3 ligases, highlighting the diversity and importance of these enzymes in cellular processes .

Related Research

While direct research findings focused solely on Os03g0188200 are sparse, studies on other E3 ubiquitin ligases in plants and related proteins provide insight into its potential functions. For example, research on OsINH2 and OsINH3, rice protein phosphatase 1 regulatory subunits, showed their involvement in reproductive growth and stress responses in rice . These proteins interact with other enzymes and regulate stress-responsive genes, suggesting that Os03g0188200 may also participate in similar regulatory networks .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and may serve as a guideline.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. To request a specific tag, please inform us during your order placement; we will prioritize your request.
Synonyms
Os03g0188200; LOC_Os03g08920; OJ1217B09.7; E3 ubiquitin-protein ligase Os03g0188200; RING-H2 finger protein Os03g0188200; RING-type E3 ubiquitin transferase Os03g0188200
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-353
Protein Length
full length protein
Species
Oryza sativa subsp. japonica (Rice)
Target Names
Os03g0188200
Target Protein Sequence
MAHRRIALAVLVTLLLSAFRPCLAQQSNDDTSKHHRSATAGGFTPTTVVVLVALITAFVL LTVFSVLINRCAQARAPPRRAFRSTASHQPVGGAAAASRASRGLDKEVVEAFPTAVYGDV KARMAAKSGPLECAVCLAEFADSDELRVLPACCHVFHPDCIDPWLAAAVTCPLCRANLTA PPVSLAAAESSDLTAPEEAVQEEESEELDEASLMATFTPESVIDFGATHDHEFDRAGYPH YRRTQSAMDAAPDRHTLRLPEHVMKELAADRRHRRAASLAGYPDSVERTPRWLTSLWRSV SWQRQSRADWDAGEEHGGSKRVHPVAGAQDETPSGSGSDGSKENSDSDALNRV
Uniprot No.

Target Background

Function
Demonstrates E3 ubiquitin-protein ligase activity in vitro.
Database Links
Subcellular Location
Membrane; Single-pass membrane protein.

Q&A

What is the functional classification of Os03g0188200 within the E3 ubiquitin ligase family?

Os03g0188200 belongs to the larger family of E3 ubiquitin ligases in rice. E3 ubiquitin ligases are classified into several subtypes based on their structural domains and mechanisms of action. Understanding the specific subfamily to which Os03g0188200 belongs can provide insights into its potential functions and regulatory mechanisms. Recent research indicates that rice E3 ligases can be categorized into RING-type, HECT-type, U-box type (also known as PUB or Plant U-Box), and RING-between-RING (RBR) types . Determining the specific subfamily through sequence analysis and structural prediction is an essential first step in characterizing this protein.

How is the expression of Os03g0188200 regulated under various environmental conditions?

The expression patterns of E3 ubiquitin ligase genes in rice vary significantly under different stress conditions. Research methodologies to analyze this include:

  • Quantitative real-time PCR (qRT-PCR) analysis following exposure to different stressors

  • Microarray or RNA-seq analysis to examine global expression changes

Similar E3 ligases show specific expression patterns—for example, some rice E3 ligases are induced by treatment with jasmonic acid (JA), ethylene (ACC), and salicylic acid (SA), which may indicate their roles in biotic stress responses . To determine Os03g0188200's expression pattern, researchers should examine its transcript levels under various treatments, including pathogen infection (e.g., Magnaporthe grisea), hormone treatments, and abiotic stresses (drought, cold, heat, and salinity) .

What are the primary protein targets of Os03g0188200 in rice cells?

Identifying the substrate proteins targeted by Os03g0188200 is fundamental to understanding its biological functions. Methodological approaches include:

  • Yeast two-hybrid screening to identify interacting proteins

  • Co-immunoprecipitation followed by mass spectrometry

  • In vitro ubiquitination assays to confirm direct ubiquitination

E3 ubiquitin ligases recognize specific proteins for ubiquitination, contributing to their regulation in various stress responses . The specificity of E3 ligases for their targets explains why plants contain so many E3 ligase genes compared to E1 and E2 enzymes in the ubiquitination pathway.

How does Os03g0188200 contribute to pathogen resistance mechanisms in rice?

The involvement of E3 ubiquitin ligases in rice disease resistance is complex and can be either positive or negative. Experimental approaches to investigate this include:

  • Virus-induced gene silencing (VIGS) or CRISPR-Cas9 knockout of Os03g0188200

  • Overexpression studies in rice

  • Pathogen challenge assays following genetic manipulation

Research shows that some E3 ligases like OsPUB39 positively regulate resistance to Magnaporthe grisea, while others like OsPUB34 and OsPUB33 negatively regulate this resistance . The mechanism likely involves regulation of reactive oxygen species (ROS) accumulation and expression of defense-related genes. For example, BMV:OsPUB39-infiltrated seedlings showed decreased resistance to M. grisea compared with control seedlings, whereas BMV:OsPUB34- and BMV:OsPUB33-infiltrated seedlings showed increased resistance .

What are the molecular mechanisms through which Os03g0188200 mediates abiotic stress responses?

E3 ubiquitin ligases can regulate abiotic stress responses through various mechanisms. To investigate Os03g0188200's role in this context, researchers should consider:

  • Analyzing physiological parameters in transgenic plants under stress conditions

  • Measuring stress-related metabolites (proline, sugars, malondialdehyde)

  • Examining expression of stress-responsive genes

Recent studies demonstrate that E3 ligases can impact drought tolerance through regulation of proline content, sugar content, and expression of drought-responsive genes . For instance, silencing of OsPUB33 led to increased drought tolerance, while silencing of OsATL69 decreased tolerance. Similarly, cold stress tolerance can be regulated through modulation of malondialdehyde (MDA) content and expression of cold-responsive genes, as seen with OsATL32 .

How does the protein structure of Os03g0188200 influence its substrate specificity?

Understanding the structural basis of E3 ligase substrate recognition is crucial for predicting function. Appropriate methodologies include:

  • Protein structure determination through X-ray crystallography or cryo-EM

  • In silico molecular docking studies

  • Mutational analysis of key domains to identify substrate recognition motifs

The specificity of E3 ubiquitin ligases for their target proteins is determined by their protein structure, particularly domains involved in substrate recognition . The abundance of E3 ligases in plant genomes (more than 1,100 in rice) is thought to be related to this need for target specificity .

What is the optimal expression system for producing recombinant Os03g0188200 for biochemical studies?

Producing functional recombinant E3 ubiquitin ligases can be challenging due to their complex structure and potential for misfolding. Researchers should consider:

  • Bacterial expression systems (E. coli) for rapid production

  • Yeast expression systems for eukaryotic post-translational modifications

  • Plant-based expression systems for native-like folding

When expressing Os03g0188200, researchers must ensure the recombinant protein retains its E3 ligase activity, which can be verified through in vitro ubiquitination assays. The choice of expression system will depend on the specific experimental requirements, including protein yield, purity, and functional authenticity.

How can gene expression profiling be used to identify downstream components regulated by Os03g0188200?

Global gene expression analysis is valuable for understanding the regulatory networks involving E3 ubiquitin ligases. Methodological approaches include:

  • Microarray or RNA-sequencing of wild-type versus Os03g0188200 knockout/overexpression lines

  • Comparison of expression profiles under various stress conditions

Research has demonstrated the utility of microarray analysis in identifying genes regulated by E3 ubiquitin ligases. For example, the following table shows differentially expressed transcription factors in response to methylglyoxal treatment, potentially regulated through ubiquitination pathways :

Probe IDAccession No.Descriptionp-valueFold change
Os.7329.1.S1_s_atLOC_Os08g42550AP2 domain containing protein, expressed0.042.58
Os.6367.1.S1_atLOC_Os01g48060Auxin response factor, putative, expressed0.022.75
Os.10817.3.S1_x_atLOC_Os11g32110Auxin response factor, putative, expressed0.012.28
OsAffx.26536.1.S1_atLOC_Os04g49230B3 DNA binding domain containing protein, expressed0.058.80
Os.11132.1.S1_s_atLOC_Os08g08120B-box zinc finger family protein, putative, expressed0.034.60

What techniques are most effective for studying the in vivo ubiquitination activity of Os03g0188200?

Detecting and quantifying ubiquitination in living plant cells presents technical challenges. Effective approaches include:

  • Immunoprecipitation followed by western blotting with anti-ubiquitin antibodies

  • Mass spectrometry-based proteomics to identify ubiquitination sites

  • Fluorescent protein-based sensors for real-time monitoring of ubiquitination

In studying E3 ligase activity, it's important to distinguish between mono-ubiquitination and poly-ubiquitination, as these modifications can lead to different outcomes for target proteins. Additionally, researchers should consider the dynamics of ubiquitination, as this process can be rapidly reversed by deubiquitinating enzymes.

How does Os03g0188200 interact with phytohormone signaling pathways in stress responses?

Phytohormones play crucial roles in plant stress adaptation, and many hormone signaling pathways depend on the ubiquitin-proteasome system. To investigate Os03g0188200's involvement in hormone signaling, researchers should:

  • Analyze changes in hormone levels in Os03g0188200 transgenic plants

  • Examine the response of Os03g0188200 to exogenous hormone treatments

  • Investigate potential interactions with known hormone signaling components

Research indicates that several E3 ubiquitin ligase genes are induced by treatment with hormones such as JA, ACC, and SA . This induction pattern correlates with their functions in response to biotic stress, suggesting hormone signaling may mediate E3 ligase activity during stress responses.

What is the evolutionary significance of Os03g0188200 in plant stress adaptation?

Understanding the evolutionary history of E3 ubiquitin ligases can provide insights into their functions. Methodological approaches include:

  • Comparative genomic analysis across plant species

  • Phylogenetic analysis of E3 ligase gene families

  • Analysis of selection pressure on different protein domains

The large number of E3 ubiquitin ligases in plant genomes (over 1,200 in rice) suggests their importance in adaptation . Evolutionary analysis can reveal conserved domains and functions, as well as species-specific adaptations that may be relevant to agricultural applications.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.