Recombinant Oryza sativa subsp. japonica E3 ubiquitin-protein ligase Os04g0590900 (Os04g0590900, LOC_Os04g50100)

Shipped with Ice Packs
In Stock

Description

General Information

Oryza sativa subsp. japonica E3 ubiquitin-protein ligase Os04g0590900, also known as Os04g0590900 or LOC_Os04g50100, is an E3 ubiquitin ligase in Oryza sativa (rice) . It functions as a member of the RING-H2 finger protein family .

Table 1: Basic Information of Os04g0590900

AttributeDescription
Recommended NameE3 ubiquitin-protein ligase Os04g0590900
Alternative Name(s)RING-H2 finger protein Os04g0590900
EC Number6.3.2.-
Gene NamesOs04g0590900, LOC_Os04g50100
ORF NamesOsJ_15972, OSJNBa0086O06.21
SpeciesOryza sativa subsp. japonica (Rice)
UniProt No.Q7XLY8
Expression Region1-383

Protein Sequence and Structure

The protein sequence of Recombinant Oryza sativa subsp. japonica E3 ubiquitin-protein ligase Os04g0590900 consists of 383 amino acids .

Table 2: Amino Acid Sequence Details

AttributeDescription
AA SequenceMASSAPAWVPYEPTRDCSQGLCSMYCPQWCYFIFPPPPPFDVAGTSADDSSGPVFSPLVIAIIGVLASAFLLVSYYTFISKYCGTVSSLRGRVFGSSSGGAAYGGGAGSGGRHGHGQSRSHESWNVSPPSGLDETLINKITVCKYRRGDGFVHTTDCSVCLGEFSDGESLRLLPRCSHAFHQQCIDTWLKSHSNCPLCRANITFVTVGLASPEPEGCAPGETGGDNTHEVVVVMDGLENLCEEQQEAVSRASTADDDHDAKDVAEGMEEANGAAEIREEGSPPKRGASSFDLHRDNRMCIADVLQESMEDELTAARESGLLAGGAGTSRRCHGENSKGRGGRSRRALQLQDAMEALPGKRLPSGGRSCFSSKSGRGKDSDHPM

It contains a RING-H2 finger domain, which is characteristic of E3 ubiquitin ligases . The protein's molecular weight and isoelectric point can be calculated based on its amino acid sequence, although specific values are not available in the provided documents.

Function

Os04g0590900 functions as an E3 ubiquitin ligase, which is involved in the ubiquitination pathway . E3 ubiquitin ligases play a crucial role in protein turnover, signal transduction, and various cellular processes by mediating the transfer of ubiquitin to target proteins .

Expression and Localization

The expression region spans from amino acid 1 to 383, indicating it is a full-length protein .

Role in Disease

The study of genes, such as FKBP11, indicates the importance of identifying prognostic biomarkers for diseases such as osteosarcoma, suggesting the potential relevance of understanding gene function for therapeutic applications . Further research may reveal its involvement in other plant stress responses or developmental processes.

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, provided as a guideline.
Shelf Life
Shelf life depends on several factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
The tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us for prioritized development.
Synonyms
Os04g0590900; LOC_Os04g50100; OsJ_15972; OSJNBa0086O06.21; E3 ubiquitin-protein ligase Os04g0590900; RING-H2 finger protein Os04g0590900; RING-type E3 ubiquitin transferase Os04g0590900
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-383
Protein Length
full length protein
Species
Oryza sativa subsp. japonica (Rice)
Target Names
Os04g0590900
Target Protein Sequence
MASSAPAWVPYEPTRDCSQGLCSMYCPQWCYFIFPPPPPFDVAGTSADDSSGPVFSPLVI AIIGVLASAFLLVSYYTFISKYCGTVSSLRGRVFGSSSGGAAYGGGAGSGGRHGHGQSRS HESWNVSPPSGLDETLINKITVCKYRRGDGFVHTTDCSVCLGEFSDGESLRLLPRCSHAF HQQCIDTWLKSHSNCPLCRANITFVTVGLASPEPEGCAPGETGGDNTHEVVVVMDGLENL CEEQQEAVSRASTADDDHDAKDVAEGMEEANGAAEIREEGSPPKRGASSFDLHRDNRMCI ADVLQESMEDELTAARESGLLAGGAGTSRRCHGENSKGRGGRSRRALQLQDAMEALPGKR LPSGGRSCFSSKSGRGKDSDHPM
Uniprot No.

Target Background

Function
Exhibits E3 ubiquitin-protein ligase activity in vitro.
Database Links
Subcellular Location
Membrane; Single-pass membrane protein.

Q&A

What is the basic function of Os04g0590900 E3 ubiquitin ligase in rice?

Os04g0590900 is an E3 ubiquitin ligase in rice (Oryza sativa subsp. japonica) that participates in the ubiquitin-proteasome system (UPS). This system regulates protein stability through ubiquitination, a post-translational modification that targets proteins for degradation via the 26S proteasome complex. As an E3 ligase, Os04g0590900 likely plays a crucial role in the specific recognition of target proteins and catalyzes the attachment of ubiquitin molecules to these targets .

The ubiquitin-proteasome system influences diverse cellular processes in plants, including signal transduction, cell division, and responses to biotic and abiotic stresses. E3 ubiquitin ligases are particularly important within this system as they determine substrate specificity, essentially deciding which proteins get marked for degradation .

How is Os04g0590900 structurally classified among E3 ubiquitin ligases?

Based on structural characteristics, Os04g0590900 belongs to the RING-type E3 ubiquitin ligase family. E3 ubiquitin ligases are broadly divided into two groups: single-subunit (including RING/U-box and HECT-type) and multi-subunit (such as SCF and APC complexes) .

The RING-type E3 ligases contain a RING finger domain characterized by a specific pattern of cysteine and histidine residues that coordinate zinc ions and are critical for E3 ligase activity. Os04g0590900 is composed of 383 amino acids and contains the characteristic RING domain necessary for its ubiquitin ligase function .

How does Os04g0590900 compare with other characterized E3 ubiquitin ligases in rice?

When comparing Os04g0590900 with other rice E3 ubiquitin ligases, several distinctions become apparent:

E3 LigaseTypeSizeKnown FunctionsStress Response
Os04g0590900RING-type383 aaNot fully characterizedUnknown
OsPUB2/OsPUB3U-box type--Cold stress responseCold tolerance
SOR1RING-type--Root ethylene response, auxin signalingEthylene response

While OsPUB2 and OsPUB3 have been extensively characterized as U-box E3 ligases that positively regulate cold stress tolerance , and SOR1 is known to control root-specific ethylene responses by modulating Aux/IAA protein stability , the specific functions of Os04g0590900 remain to be fully elucidated through comparative studies with these better-characterized rice E3 ligases.

What methods are recommended to verify the E3 ligase activity of Os04g0590900?

To verify the E3 ligase activity of Os04g0590900, researchers should employ the in vitro self-ubiquitination assay, which is the gold standard for confirming E3 ligase functionality. Based on established protocols for other rice E3 ligases, this would involve:

  • Expressing and purifying the recombinant Os04g0590900 protein with an epitope tag (e.g., His-tag or Myc-tag) from a bacterial expression system like E. coli .

  • Conducting an in vitro ubiquitination reaction containing:

    • Purified recombinant Os04g0590900

    • E1 ubiquitin-activating enzyme (e.g., Arabidopsis UBA1)

    • E2 ubiquitin-conjugating enzyme (e.g., Arabidopsis UBC8)

    • Ubiquitin

    • ATP

    • Appropriate reaction buffer

  • Incubating the reaction at 30°C for approximately 2 hours.

  • Analyzing the reaction products by SDS-PAGE followed by immunoblotting with both anti-tag antibodies (to detect the recombinant protein) and anti-ubiquitin antibodies .

E3 ligase activity is confirmed when high-molecular-mass ubiquitinated bands are detected with both antibodies. Control reactions omitting E1, E2, ATP, or ubiquitin should be included to confirm specificity. Additionally, generating a catalytic site mutant (e.g., by mutating the conserved cysteine residue in the RING domain to alanine) can serve as a negative control .

How can researchers identify potential target proteins of Os04g0590900?

To identify potential targets of Os04g0590900, researchers should implement a multi-faceted approach:

  • Yeast Two-Hybrid (Y2H) Screening: Use Os04g0590900 as bait to screen a rice cDNA library to identify potential interacting proteins. This approach has successfully identified interactions between other E3 ligases and their targets, such as the interaction between SOR1 and OsIAA26/OsIAA9 .

  • Co-Immunoprecipitation (Co-IP) Coupled with Mass Spectrometry: Express tagged Os04g0590900 in rice cells, perform immunoprecipitation, and identify co-precipitated proteins by mass spectrometry analysis.

  • In Vitro Ubiquitination Assays: Test candidate targets identified from Y2H or Co-IP in in vitro ubiquitination assays to confirm they can be ubiquitinated by Os04g0590900.

  • Degradation Assays: Perform cell-free protein degradation assays with candidate targets in the presence and absence of Os04g0590900 to monitor protein stability over time.

  • Protein Interaction Validation: Confirm direct interactions using techniques such as in vitro pull-down assays with recombinant proteins .

  • Genetic Analysis: Generate transgenic rice lines with altered Os04g0590900 expression and analyze the stability of potential target proteins in these lines compared to wild-type plants.

This comprehensive approach will help distinguish between proteins that directly interact with Os04g0590900 and those that are specifically targeted for ubiquitination and subsequent degradation.

What approaches can be used to determine the subcellular localization of Os04g0590900?

Determining the subcellular localization of Os04g0590900 is crucial for understanding its biological function. Several complementary approaches should be used:

  • Fluorescent Protein Fusion Analysis:

    • Generate C-terminal and N-terminal fusions of Os04g0590900 with GFP or other fluorescent proteins

    • Express these constructs in rice protoplasts or transgenic rice plants

    • Visualize using confocal microscopy to determine localization patterns

    • Compare with established subcellular markers to identify specific compartments

  • Co-localization Studies:

    • Co-express Os04g0590900-FP with known organelle markers

    • Perform similar analysis with other rice E3 ligases (e.g., OsPUB2/OsPUB3) that have established localization patterns, such as the exocyst positive organelle (EXPO)-like punctate structures observed for OsPUB2/OsPUB3

  • Cellular Fractionation and Western Blotting:

    • Separate cellular components (nuclear, cytosolic, microsomal fractions)

    • Detect Os04g0590900 in each fraction using specific antibodies

    • Compare distribution with known organelle-specific proteins

  • Immunogold Electron Microscopy:

    • Provide ultrastructural resolution of protein localization

    • Use specific antibodies against Os04g0590900 conjugated to gold particles

    • Visualize in thin sections of rice cells using electron microscopy

Learning from studies of other rice E3 ligases, it's important to note that these proteins may show complex localization patterns. For example, OsPUB2 was found in both EXPO-like punctate structures and nuclei, while OsPUB3 was primarily localized to EXPO-like structures , suggesting that subcellular localization can provide clues to functional specificity.

How can researchers determine if Os04g0590900 is involved in abiotic stress responses?

To investigate the potential role of Os04g0590900 in abiotic stress responses, researchers should implement a systematic approach combining gene expression analysis, gain- and loss-of-function studies, and comparative analysis with known stress-responsive E3 ligases:

  • Stress-responsive Expression Analysis:

    • Expose rice plants to various abiotic stresses (cold, heat, drought, salinity, flooding)

    • Monitor Os04g0590900 transcript levels using qRT-PCR at different time points

    • Compare expression patterns with known stress-responsive genes

    • This approach revealed that OsPUB2 was up-regulated by low temperature (4°C), suggesting its role in cold stress response

  • Generation and Characterization of Transgenic Lines:

    • Develop Os04g0590900-overexpressing rice lines

    • Generate knockout/knockdown lines using CRISPR/Cas9 or RNAi

    • Phenotype these lines under normal and stress conditions

    • Measure physiological parameters (ROS levels, MDA content, electrolyte leakage)

    • Assess stress tolerance through survival rates, growth parameters, and yield components

  • Comparative Stress Tolerance Assays:

    • Subject transgenic and wild-type plants to controlled stress conditions

    • Document phenotypic differences including growth metrics, chlorophyll content, and photosynthetic efficiency

    • Similar methods revealed that OsPUB2/OsPUB3-overexpressing transgenic rice exhibited enhanced tolerance to cold stress compared to wild-type plants

  • Cellular and Molecular Analysis:

    • Identify changes in stress-responsive protein levels in transgenic vs. wild-type plants

    • Determine if specific stress response pathways are altered using transcriptome/proteome analysis

    • Investigate potential substrates whose stability is affected during stress conditions

What evidence would suggest Os04g0590900 functions in biotic stress responses?

To evaluate the potential role of Os04g0590900 in biotic stress responses, researchers should combine molecular, genetic, and pathological approaches:

  • Pathogen-Responsive Expression Analysis:

    • Challenge rice plants with common pathogens (e.g., Magnaporthe oryzae, Xanthomonas oryzae)

    • Monitor Os04g0590900 expression over the infection time course

    • Compare with known defense-related genes and other E3 ligases

  • Genetic Analysis with Pathogen Challenge:

    • Assess the response of Os04g0590900 overexpression and knockout/knockdown lines to pathogen infection

    • Measure disease progression parameters (lesion size, pathogen growth)

    • Quantify defense-related metabolites (phytoalexins, PR proteins)

  • Interaction with Defense Signaling Components:

    • Investigate potential interactions with known immune receptors or defense signaling proteins

    • Determine if Os04g0590900 affects the stability of defense-related proteins

    • Analyze correlation with defense-related gene expression patterns

  • Comparative Analysis with Defense-Related E3 Ligases:

    • Examine similarity to RGA4-like disease resistance proteins that function in plant immunity

    • The search results mention several putative disease resistance proteins (RGA4) with E3 ligase activity in plants, indicating potential similar functions in Os04g0590900

The discovery that Os04g0590900 targets defense-related proteins for degradation, or that its expression is induced during pathogen infection, would strongly suggest a role in plant immunity and biotic stress responses.

How does Os04g0590900 potentially integrate into hormone signaling networks?

Plant hormones play crucial roles in coordinating stress responses and development. To investigate Os04g0590900's involvement in hormone signaling, researchers should:

  • Hormone-Responsive Expression Analysis:

    • Treat rice plants with different hormones (auxin, ethylene, ABA, gibberellins, jasmonates)

    • Monitor Os04g0590900 transcript levels at various time points post-treatment

    • Compare expression patterns with known hormone-responsive genes

  • Protein Interaction with Hormone Signaling Components:

    • Perform Y2H and Co-IP experiments to identify interactions with hormone signaling proteins

    • Focus particularly on auxin and ethylene pathways, as other rice E3 ligases like SOR1 are known to regulate these pathways by targeting proteins such as OsIAA26 and OsIAA9

    • Test if Os04g0590900 interacts with any Aux/IAA proteins, a hallmark of several E3 ligases involved in auxin signaling

  • Hormonal Response Phenotypes in Transgenic Lines:

    • Assess the sensitivity of Os04g0590900 overexpression and knockout lines to various hormones

    • Measure root growth inhibition, shoot elongation, and other hormone-specific responses

    • Similar approaches revealed that SOR1 controls root-specific ethylene responses by modulating Aux/IAA protein stability

  • Target Identification and Validation:

    • Identify if Os04g0590900 targets any transcription factors or repressors involved in hormone signaling

    • Validate these targets through in vitro and in vivo degradation assays

    • Determine if hormone application affects the interaction between Os04g0590900 and its targets

How can researchers exploit Os04g0590900 to engineer stress-tolerant rice varieties?

Leveraging Os04g0590900 for crop improvement requires sophisticated biotechnological approaches:

  • Optimized Gene Manipulation Strategies:

    • Fine-tune Os04g0590900 expression using tissue-specific or stress-inducible promoters

    • Create precision-edited variants with enhanced activity or altered target specificity using CRISPR/Cas9

    • Develop transgenic lines with both enhanced stress tolerance and minimal growth penalties

  • Identification of Superior Natural Alleles:

    • Screen rice germplasm collections for natural variations in Os04g0590900

    • Correlate allelic differences with stress tolerance phenotypes

    • Introduce beneficial alleles into elite cultivars using marker-assisted breeding

  • Pathway Engineering:

    • Manipulate both Os04g0590900 and its key targets simultaneously

    • Optimize the entire ubiquitination pathway by modifying E2 enzymes that function with Os04g0590900

    • Create synthetic regulatory circuits that activate Os04g0590900-mediated responses under specific stress conditions

  • Field Validation Protocol:

    • Evaluate engineered lines under multiple field conditions across different environments

    • Assess yield stability, stress resilience, and agronomic performance

    • Measure stress-related physiological parameters in field-grown plants

  • Integration with Other Tolerance Mechanisms:

    • Combine Os04g0590900 modifications with other stress tolerance genes

    • Develop pyramided lines with multiple E3 ligases targeting different aspects of stress response

    • Similar approaches with OsPUB2/OsPUB3 have demonstrated enhanced cold tolerance in rice

What experimental designs would best resolve contradictory data regarding Os04g0590900 function?

When faced with contradictory results regarding Os04g0590900 function, researchers should implement the following experimental strategies:

  • Standardized Phenotyping Protocols:

    • Establish precise growth conditions and stress application methods

    • Use multiple genetically diverse rice varieties to account for background effects

    • Implement quantitative phenotyping approaches with statistical rigor

  • Multi-omics Integrative Analysis:

    • Combine transcriptomics, proteomics, and metabolomics data

    • Map changes across multiple levels of cellular organization

    • Identify convergent evidence that supports specific functional hypotheses

    • Analyze both early and late responses to distinguish direct from indirect effects

  • Tissue-Specific Function Analysis:

    • Generate tissue-specific knockouts using CRISPR/Cas9 with tissue-specific promoters

    • Perform tissue-specific transcriptome analysis to identify local vs. systemic effects

    • Determine if contradictory results stem from different tissue-specific functions

  • Protein Interaction Network Mapping:

    • Construct comprehensive interaction networks under different conditions

    • Identify condition-specific interactors that might explain divergent functions

    • Compare with networks of other E3 ligases such as OsPUB2/OsPUB3 and SOR1

  • Temporal Dynamics Investigation:

    • Implement time-course experiments with high temporal resolution

    • Use inducible expression systems to control precise timing of Os04g0590900 activity

    • Distinguish between early direct effects and later adaptive responses

What are the methodological challenges in studying the combinatorial effects of multiple E3 ligases including Os04g0590900?

Investigating how Os04g0590900 functions in concert with other E3 ligases presents several methodological challenges that require sophisticated approaches:

  • Functional Redundancy Assessment:

    • Generate higher-order mutants combining Os04g0590900 with related E3 ligases

    • Develop quantitative assays to measure additive, synergistic, or antagonistic effects

    • Implement CRISPR multiplexing to simultaneously target multiple E3 ligases

  • Substrate Competition Analysis:

    • Develop in vitro systems to test multiple E3 ligases simultaneously

    • Use quantitative proteomics to identify differentially degraded substrates

    • Utilize competition assays with purified components to determine substrate preference

  • Heterodimer Formation Investigation:

    • Assess if Os04g0590900 forms heterodimers with other E3 ligases

    • Determine if heterodimer formation alters enzyme activity or substrate specificity

    • Studies with OsPUB2 and OsPUB3 demonstrated that these E3 ligases form both homo-dimers and hetero-dimers, with the hetero-dimeric complex showing greater stability

  • E2-E3 Specificity Mapping:

    • Identify which E2 enzymes preferentially work with Os04g0590900

    • Determine if E2 enzyme availability creates competition between different E3 ligases

    • Test if manipulating E2 levels affects the balance of activities between E3 ligases

  • Systems Biology Approach:

    • Develop computational models of the ubiquitination network

    • Predict emergent properties from multiple E3 ligase interactions

    • Validate model predictions through targeted experimental manipulation

What are the most promising research directions for Os04g0590900?

Based on current knowledge of E3 ubiquitin ligases in rice, several promising research directions for Os04g0590900 emerge:

  • Target Identification and Validation: Identifying the specific proteins targeted by Os04g0590900 for ubiquitination will provide crucial insights into its biological function. Approaches combining proteomics, protein interaction studies, and in vitro ubiquitination assays will be essential.

  • Stress Response Integration: Investigating how Os04g0590900 functions in abiotic and biotic stress responses will help establish its role in rice stress tolerance. Comparative analysis with better-characterized E3 ligases like OsPUB2/OsPUB3 (cold stress) and SOR1 (ethylene response) will provide valuable context .

  • Hormone Signaling Networks: Exploring potential connections between Os04g0590900 and hormone signaling pathways, particularly auxin and ethylene signaling, may reveal important regulatory mechanisms similar to those identified for SOR1 .

  • Breeding Applications: Developing Os04g0590900-based strategies for enhancing stress tolerance in rice varieties has significant agricultural potential, especially if Os04g0590900 proves to be involved in multiple stress responses.

  • Comparative Evolution: Examining the evolution of Os04g0590900 across different rice varieties and related grass species will help understand its conservation and potential functional divergence.

These research directions will contribute significantly to our understanding of ubiquitin-mediated protein regulation in rice and may lead to practical applications in crop improvement.

How should researchers prioritize Os04g0590900 studies in relation to other rice E3 ligases?

Researchers should consider the following factors when prioritizing studies on Os04g0590900 relative to other rice E3 ligases:

  • Sequence Conservation: Assess the evolutionary conservation of Os04g0590900 across rice varieties and related species. Highly conserved E3 ligases often regulate fundamental processes and may warrant higher priority.

  • Expression Profile Analysis: Examine tissue-specific and stress-responsive expression patterns. E3 ligases with condition-specific expression patterns may regulate specialized processes.

  • Preliminary Phenotypic Data: Generate initial knockout and overexpression lines to assess visible phenotypes. Strong phenotypes may indicate important biological roles.

  • Integration with Existing Knowledge: Position Os04g0590900 within the context of known E3 ligase networks and pathways. Consider its relationship with better-characterized E3 ligases like OsPUB2/OsPUB3 and SOR1 .

  • Potential Agricultural Impact: Evaluate the potential for crop improvement applications based on preliminary data and comparative analysis with other E3 ligases known to influence agronomically important traits.

By systematically evaluating these factors, researchers can develop a rational prioritization strategy that maximizes the scientific and practical impact of Os04g0590900 studies within the broader context of rice E3 ligase research.

What technological innovations could accelerate research on Os04g0590900 and related E3 ligases?

Several emerging technologies could significantly advance research on Os04g0590900 and other rice E3 ligases:

  • Proximity-based Labeling Technologies:

    • Implement BioID or TurboID fusion proteins to identify proteins in proximity to Os04g0590900 in vivo

    • This would help identify both substrates and interacting partners under various conditions

  • Single-cell Omics Approaches:

    • Apply single-cell transcriptomics and proteomics to understand cell-type-specific functions

    • Resolve conflicting data that may arise from cellular heterogeneity

  • Advanced Live Cell Imaging:

    • Develop FRET-based sensors to monitor Os04g0590900 activity in real-time

    • Implement optogenetic tools to control Os04g0590900 activity with spatial and temporal precision

  • Cryo-EM Structural Analysis:

    • Determine high-resolution structures of Os04g0590900 alone and in complexes with substrates

    • Use structural insights to design specific inhibitors or enhancers

  • AI-assisted Prediction Tools:

    • Develop machine learning algorithms to predict E3-substrate pairs

    • Use structural prediction tools (like AlphaFold) to model interaction interfaces

  • High-throughput Ubiquitination Assays:

    • Design multiplexed assays to simultaneously test multiple potential substrates

    • Develop cell-free systems that recapitulate the entire ubiquitination cascade

  • CRISPR Base Editing Technologies:

    • Use precision editing to create specific amino acid substitutions without disrupting the entire gene

    • Generate allelic series to study structure-function relationships

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.