Recombinant Oryza sativa subsp. japonica E3 ubiquitin-protein ligase Os06g0535400 (Os06g0535400, LOC_Os06g34450)

Shipped with Ice Packs
In Stock

Description

General Information

Recombinant Oryza sativa subsp. japonica E3 ubiquitin-protein ligase Os06g0535400, also known as Os06g0535400 or LOC_Os06g34450, is a protein found in Oryza sativa subsp. japonica (rice) . It contains a zinc finger, C3HC4 type domain . The protein is expressed .

Function and Characteristics

As an E3 ubiquitin-protein ligase, Os06g0535400 is involved in the ubiquitination pathway, which is a crucial process in cells that regulates protein turnover, signal transduction, and DNA repair . E3 ligases confer specificity to the ubiquitination process by recognizing specific protein substrates and facilitating the transfer of ubiquitin to these targets . The presence of a zinc finger C3HC4-type domain suggests that Os06g0535400 may interact with DNA or other proteins, influencing its role in gene expression or protein complex formation .

Genomic Context and Expression

The gene encoding Os06g0535400 is located on chromosome 6 of Oryza sativa subsp. japonica . The protein is expressed, suggesting it has a functional role within the plant .

Role in Plant Biology

Because Os06g0535400 is an E3 ubiquitin ligase, it may play a role in:

  • Protein degradation Ubiquitination often marks proteins for degradation by the proteasome .

  • Signal transduction Ubiquitination can modify the activity of signaling proteins, affecting plant responses to various stimuli .

  • Stress response E3 ligases are often involved in regulating plant responses to biotic and abiotic stresses .

  • Developmental processes Ubiquitination is essential for regulating plant growth and development .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Our proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type will be determined during production. If you require a specific tag, please inform us; we will prioritize development of the specified tag.
Synonyms
Os06g0535400; LOC_Os06g34450; OSJNBa0001B21.23; E3 ubiquitin-protein ligase Os06g0535400; RING-H2 finger protein Os06g0535400; RING-type E3 ubiquitin transferase Os06g0535400
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-251
Protein Length
full length protein
Species
Oryza sativa subsp. japonica (Rice)
Target Names
Os06g0535400
Target Protein Sequence
MELPWLDLPFTLLTLLLATRLAYDYYGVVAATFTGSFSLQIFLFYCFARWYRHTIAARAA ADADGDGGGGAVADEEAAPPVLIPLLEGRGGGGGGAGAASSLANRCFAVVFMVFVPLVIV VFERSQADVVAYALCLANILVMVVWLSPDAAADPASAAKSFLRLSDDEDEGSCSGSGHGA AEDKCCVCLAGMREAQALRDLPRCGHRFHAKCIGKWLTAHPTCPVCRTTAVPPPAPLPAS GDHADDAITPV
Uniprot No.

Target Background

Function
E3 ubiquitin-protein ligase activity demonstrated *in vitro*.
Database Links

KEGG: osa:4341214

STRING: 39947.LOC_Os06g34450.1

UniGene: Os.5874

Subcellular Location
Membrane; Multi-pass membrane protein.

Q&A

What is the structural classification of Os06g0535400 E3 ubiquitin ligase?

Os06g0535400 belongs to the RING-type (Really Interesting New Gene) E3 ubiquitin ligase family. As indicated in the protein details, it contains a RING-H2 finger domain characteristic of this class of E3 ligases. RING-type E3 ligases constitute one of the three main monomeric types of E3 ubiquitin ligases found in plants, alongside HECT-type and U-box type ligases. The RING domain facilitates the transfer of ubiquitin from an E2 conjugating enzyme to target substrates without forming an intermediary ubiquitin-E3 thioester bond .

How prevalent are E3 ubiquitin ligases in the rice genome?

The rice genome contains more than 1100 genes encoding E3 ubiquitin ligases, comparable to Arabidopsis and maize. This abundance is believed to be related to their specificity for target proteins. E3 ubiquitin ligases represent the largest and most diverse group of enzymes in the ubiquitination pathway, reflecting their critical role in providing substrate specificity to the ubiquitination system .

What are the optimal conditions for expressing recombinant Os06g0535400 in bacterial systems?

For bacterial expression of Os06g0535400, optimization of several parameters is essential:

Expression System Selection:

  • BL21(DE3) or Rosetta(DE3) E. coli strains are recommended for RING-type E3 ligases to address potential codon bias issues

  • Use pET-based vectors with T7 promoter for controlled induction

Expression Conditions:

ParameterRecommended ConditionRationale
Temperature16-18°CReduces inclusion body formation
IPTG concentration0.1-0.3 mMLower concentrations favor soluble protein
Induction time16-20 hoursExtended time at lower temperature improves folding
MediaTB or 2XYT with supplementsProvides nutrients for extended expression
Additives0.1% glucose, 5-10 mM ZnCl₂Stabilizes the RING domain

It's crucial to include zinc in the expression media since the RING domain is a zinc-coordinating structure. Post-expression, purification should be conducted using immobilized metal affinity chromatography (IMAC) followed by size exclusion chromatography to ensure high purity .

How can I design an effective in vitro ubiquitination assay to test Os06g0535400 activity?

An effective in vitro ubiquitination assay requires the following components and methodology:

Required Components:

  • Purified recombinant Os06g0535400 (E3 ligase)

  • E1 ubiquitin-activating enzyme (commercial AtUBA1 or rice homolog)

  • E2 ubiquitin-conjugating enzyme (multiple candidates should be tested for compatibility)

  • Ubiquitin (preferably tagged, e.g., HA-Ub or FLAG-Ub)

  • ATP regeneration system (ATP, creatine phosphate, creatine kinase)

  • Potential substrate proteins (can be tested from rice extract or known candidates)

Assay Protocol:

  • Mix E1 (50-100 nM), E2 (0.5-1 μM), E3 Os06g0535400 (0.5-2 μM), ubiquitin (10-50 μM), and substrate (1-5 μM) in reaction buffer

  • Include necessary cofactors: 5 mM ATP, 5 mM MgCl₂, 0.1 mM DTT, pH 7.5

  • Incubate at 30°C for 1-3 hours

  • Analyze by SDS-PAGE followed by western blotting using anti-ubiquitin antibodies

Control reactions omitting individual components are essential to verify enzyme-dependent ubiquitination. For target identification, this assay can be coupled with mass spectrometry to identify ubiquitinated substrates when using rice protein extracts .

What methodologies are most effective for studying Os06g0535400 localization in plant cells?

Multiple complementary approaches can be used to study the subcellular localization of Os06g0535400:

Fluorescent Protein Fusion Approaches:

  • N- and C-terminal GFP/YFP fusions to observe localization in live cells

  • Transient expression in rice protoplasts for quick analysis

  • Stable transformation for studying localization under different conditions or stresses

Immunolocalization Techniques:

  • Generation of specific antibodies against Os06g0535400

  • Immunofluorescence microscopy with subcellular markers

Biochemical Fractionation:

  • Differential centrifugation to separate cellular compartments

  • Western blotting of fractions to detect native protein

Based on other E3 ubiquitin ligases in rice, membrane association might be expected, as several RING-type E3 ligases localize to specific membranes. For example, OsRMT1, another rice RING-finger E3 ligase, localizes to microtubules and the nucleus, while OsSIRP2 shuttles between the nucleus and cytoplasm depending on stress conditions .

How does Os06g0535400 respond to different abiotic stress conditions?

While specific data for Os06g0535400 is limited in the search results, we can infer likely responses based on other RING-type E3 ligases in rice:

Expression Pattern Analysis Under Stress Conditions:

Stress TypeExpected ResponseExperimental Approach
DroughtPotential upregulationqRT-PCR analysis at different time points after drought treatment
SalinityLikely responsiveRNA-seq and qRT-PCR validation in salt-treated plants
ColdVariable responseLow-temperature treatment time course
HeatOften upregulatedHigh-temperature exposure analysis

Many rice E3 ligases show transcriptional responses to multiple stresses. For instance, OsSIRP2 is induced by high salinity, drought, and ABA treatment. Similarly, OsRMT1 plays a role in salinity stress response. Experimental validation of Os06g0535400's specific responses would require stress treatments of rice plants followed by expression analysis .

What role might Os06g0535400 play in phytohormone signaling pathways?

E3 ubiquitin ligases in rice frequently participate in phytohormone signaling cascades. Based on studies of other rice E3 ligases, Os06g0535400 might be involved in:

Potential Phytohormone Interactions:

  • ABA signaling: Many RING E3 ligases respond to and mediate ABA responses

  • JA signaling: E3 ligases often regulate JA-responsive transcription factors

  • SA signaling: Several E3 ligases modulate SA-dependent defense responses

To determine specific involvement, experiments should include:

  • Expression analysis of Os06g0535400 after hormone treatments (ABA, JA, SA, ethylene)

  • Phenotypic analysis of plants with altered Os06g0535400 expression under hormone treatments

  • Identification of hormone-related transcription factors or signaling components that might be Os06g0535400 substrates

The expression of E3 ubiquitin ligase genes like OsPUB39, OsPUB34, and OsPUB33 is induced by treatment with JA, ACC (ethylene precursor), and SA, indicating their function in hormone-mediated stress responses .

How can we identify potential target substrates of Os06g0535400?

Identifying the target substrates of an E3 ubiquitin ligase is crucial for understanding its biological function. Multiple complementary approaches should be employed:

Recommended Substrate Identification Strategies:

  • Yeast Two-Hybrid (Y2H) Screening:

    • Use the RING domain or full-length Os06g0535400 as bait

    • Screen against rice cDNA libraries

    • Validate interactions in planta

  • Co-Immunoprecipitation (Co-IP) with Mass Spectrometry:

    • Express tagged Os06g0535400 in rice

    • Perform immunoprecipitation followed by mass spectrometry

    • Include proteasome inhibitors to stabilize interactions

  • Proteomics Approach:

    • Compare ubiquitinome profiles between wild-type and Os06g0535400-overexpression/knockout plants

    • Identify differentially ubiquitinated proteins

  • Candidate Approach Based on Homology:

    • Test interaction with substrates of related E3 ligases

The development of rice UbE3-ORFeome library containing 98.94% of the 1515 E3 ligase genes provides a powerful resource for such studies, enabling systematic screening for E3-substrate interactions .

What is the mechanism of non-proteolytic ubiquitination by Os06g0535400 and how does it impact target protein function?

Non-proteolytic ubiquitination represents an advanced research area for E3 ligases like Os06g0535400:

Mechanistic Investigation Approaches:

  • Characterize ubiquitin chain topology (K48, K63, K11, etc.) formed by Os06g0535400

  • Analyze mono- vs. poly-ubiquitination patterns on targets

  • Determine how these modifications affect target protein:

    • Localization changes

    • Protein-protein interactions

    • Enzyme activity alterations

    • Signal transduction capabilities

Recent research indicates that rice E3 ubiquitin ligases like OsCIE1 and IPI7 mediate non-proteolytic polyubiquitination of their targets, modulating protein function rather than degradation. This mechanism plays crucial roles in balancing immunity and yield in rice .

How can CRISPR/Cas9 gene editing be optimized for functional characterization of Os06g0535400?

CRISPR/Cas9 gene editing offers powerful approaches for functional characterization:

Optimization Strategies:

  • gRNA Design and Selection:

    • Target conserved domains (RING domain) for complete loss-of-function

    • Target regulatory regions for expression modulation

    • Use multiple gRNAs to create large deletions

  • Transformation Optimization:

    • Agrobacterium-mediated transformation of rice calli

    • Optimize selection markers and regeneration conditions

  • Functional Validation Approaches:

    • Phenotypic characterization under multiple stress conditions

    • Transcriptome analysis of mutant lines

    • Proteomic analysis focusing on ubiquitinated proteins

  • Advanced Editing Strategies:

    • Base editing for specific amino acid changes

    • Prime editing for precise modifications

    • Conditional knockout systems for temporal control

The prospect of using genetic modification tools like CRISPR/Cas9 for producing E3 ligase transgenic crops better suited for stress-prone environments is mentioned in the literature as a promising future direction .

How do protein-protein interactions and subcellular dynamics of Os06g0535400 change under different stress conditions?

Advanced imaging and interaction studies can reveal the dynamic nature of Os06g0535400:

Research Methodologies:

  • Advanced Microscopy Techniques:

    • FRET/FLIM analysis to study protein-protein interactions in vivo

    • Photoconvertible fluorescent tags to track protein movement

    • Super-resolution microscopy for detailed localization

  • Interactome Changes Under Stress:

    • Comparative interactomics under normal vs. stress conditions

    • Temporal analysis of interaction dynamics during stress response

  • Post-translational Modification Analysis:

    • Phosphorylation status of Os06g0535400 under stress

    • How modifications affect E3 ligase activity and localization

Other rice E3 ligases show interesting dynamics - OsSIRP2 shuttles from nucleus to cytoplasm under salt stress to target OsTKL1 for degradation, while OsRMT1 is stabilized under salinity stress conditions through inhibition of its self-ubiquitination .

How can high-throughput phenotypic data from Os06g0535400 transgenic lines be effectively analyzed?

Analysis of complex phenotypic data requires sophisticated approaches:

Data Analysis Framework:

  • Experimental Design Considerations:

    • Multiple independent transgenic lines (overexpression, knockdown, knockout)

    • Control and stress conditions in replicated experiments

    • Time-series measurements for dynamic responses

  • Multi-dimensional Data Analysis:

    • Principal Component Analysis (PCA) to identify major sources of variation

    • Hierarchical clustering to group similar phenotypes

    • Machine learning approaches for complex pattern recognition

  • Integrative Analysis:

    • Correlation between phenotypic, transcriptomic and proteomic data

    • Network analysis to position Os06g0535400 in larger biological pathways

Example Data Table Format for Phenotypic Analysis:

GenotypeTreatmentPlant Height (cm)Biomass (g)Chlorophyll ContentStress Tolerance IndexROS LevelsUbiquitination Index
WTControl85.3 ± 3.212.4 ± 0.842.5 ± 1.91.00100 ± 8100 ± 5
WTDrought65.1 ± 4.18.2 ± 0.728.9 ± 2.30.66258 ± 22185 ± 12
Os06g0535400-OXControl82.7 ± 3.811.8 ± 0.941.8 ± 2.10.9892 ± 7143 ± 9
Os06g0535400-OXDrought74.9 ± 3.510.3 ± 0.836.2 ± 1.80.83142 ± 15225 ± 18
Os06g0535400-KOControl80.2 ± 4.011.6 ± 1.040.1 ± 2.20.94115 ± 1072 ± 6
Os06g0535400-KODrought52.3 ± 5.26.4 ± 0.922.5 ± 2.50.51325 ± 28138 ± 11

Such comprehensive data presentation enables researchers to visualize multiple parameters simultaneously and identify patterns in the plant's response to stress conditions .

How can researchers effectively compare sequence variations in Os06g0535400 across different rice varieties and correlate with stress tolerance?

Analyzing natural variation in Os06g0535400 across rice varieties:

Methodological Approach:

  • Sequence Data Collection and Analysis:

    • Extract Os06g0535400 sequences from the 3000 Rice Genomes Project

    • Identify SNPs, insertions, deletions, and structural variations

    • Analyze variations in coding regions, regulatory elements, and splicing sites

  • Functional Domain Analysis:

    • Focus on variations in the RING domain and other functional motifs

    • Predict impact on protein function using tools like PROVEAN, SIFT

  • Haplotype Analysis and Association Studies:

    • Construct haplotype network for Os06g0535400

    • Correlate haplotypes with geographical distribution and environmental conditions

    • Perform association analysis with stress tolerance phenotypes

Recent findings indicate that single amino acid variations in E3 ubiquitin ligase target proteins have contributed to geographic adaptation in rice, highlighting the importance of studying natural variation in the ubiquitination pathway. The availability of over 3000 sequenced rice genomes provides a rich resource for investigating natural variations in E3 ligases like Os06g0535400 .

How can transcriptome and proteome data be integrated to understand the regulatory network involving Os06g0535400?

Integrative multi-omics approaches offer powerful insights:

Integration Framework:

  • Data Collection:

    • Transcriptome (RNA-seq) of Os06g0535400 transgenic lines under different conditions

    • Proteome profiling with focus on protein abundance changes

    • Ubiquitinome analysis to identify differentially ubiquitinated proteins

    • PTM profiling (phosphoproteome, acetylome) for regulatory interactions

  • Data Processing and Integration:

    • Normalize and process individual datasets

    • Identify correlations between transcript and protein levels

    • Map ubiquitination sites to protein structures

    • Construct integrated regulatory networks

  • Visualization and Modeling:

    • Use Cytoscape or similar tools for network visualization

    • Apply machine learning for pattern recognition

    • Develop predictive models for stress response

  • Validation:

    • Test predictions through targeted experiments

    • Validate key regulatory connections using genetic approaches

The use of the rice UbE3-ORFeome library containing 98.94% of E3 ligase genes enables systematic establishment of functional E3-substrate interactomes, providing a foundation for understanding the complex regulatory networks involving E3 ligases like Os06g0535400 .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.