Recombinant Oryza sativa subsp. japonica GDT1-like protein 1, chloroplastic (Os01g0221700, LOC_Os01g12220)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we will prioritize shipping the format currently in stock, we are happy to accommodate any special requests for the format. Please specify your preference when placing your order and we will prepare accordingly.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributor for specific delivery times.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please communicate with us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging this vial before opening to ensure the contents settle at the bottom. Please reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting the solution at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a reference.
Shelf Life
The shelf life of our proteins is influenced by various factors, including storage conditions, buffer ingredients, storage temperature, and the protein's inherent stability.
Generally, liquid forms have a shelf life of 6 months at -20°C/-80°C. Lyophilized forms have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple use. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type in mind, please inform us and we will prioritize its development.
Synonyms
Os01g0221700; LOC_Os01g12220; OsJ_00919; P0443E05.5; P0483F08.42; GDT1-like protein 1, chloroplastic
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
58-341
Protein Length
Full Length of Mature Protein
Species
Oryza sativa subsp. japonica (Rice)
Target Names
Os01g0221700
Target Protein Sequence
ASDEEGPPEPAGQGRGGGRAWPSLDASSCGLALAAAAGVLMLQGSQQALAGTEFMGMQDV VGDLGDISTGFASAFLLIFFSELGDRTFFIAALLAARNSGAIIFLGTFGALAVMTIISVV LGRAFHYVDGIIPFSFGGTDFPVDDFLAACLLVYYGITTLLDAASGDEEKMNEEQEEAEL AVSKFLGNGAGIISAASTIASTFVLVFIAEWGDKSFFSTIALAAASSPLGVIAGSLAGHA VATLIAVLGGSLLGTFLSEKIVAYIGGSLFLAFAAVTLVEIVNS
Uniprot No.

Target Background

Database Links
Protein Families
GDT1 family
Subcellular Location
Plastid, chloroplast membrane; Multi-pass membrane protein.

Q&A

What is GDT1-like protein 1 and what is its significance in rice plants?

GDT1-like protein 1 (Os01g0221700, LOC_Os01g12220) is a chloroplast-localized protein in Oryza sativa subsp. japonica (rice). The protein belongs to the GDT1 family, which plays important roles in cellular ion homeostasis, particularly calcium transport and signaling. In rice plants, this protein is characterized by its transmembrane structure and localization within the chloroplast organelle, suggesting its involvement in photosynthetic processes or chloroplast ion regulation. The protein has gained research interest due to its potential role in stress response mechanisms and cellular signaling pathways in rice plants.

Based on the available amino acid sequence data, GDT1-like protein 1 contains multiple transmembrane domains characteristic of membrane transport proteins. The full amino acid sequence includes "ASDEEGPPEPAGQGRGGGRAWPSLDASSCGLALAAAAGVLMLQGSQQALAGTEF..." which is consistent with other GDT1 family proteins . Researchers should note that this protein's functional significance may extend to drought tolerance, salt stress response, and other abiotic stress adaptation mechanisms common in rice research.

What methods are recommended for the expression and purification of recombinant GDT1-like protein 1?

For successful expression and purification of recombinant GDT1-like protein 1, researchers should consider several methodological approaches. The protein can be expressed in various systems, with E. coli being commonly used for initial studies. When expressing membrane proteins like GDT1-like protein 1, specialized expression strains such as BL21(DE3), C41(DE3), or Rosetta™ are recommended to overcome toxicity and codon usage issues.

For purification, a general protocol includes:

  • Cell lysis using a combination of detergents (e.g., 1% DDM or CHAPS) and mechanical disruption

  • Initial purification via affinity chromatography (Ni-NTA for His-tagged constructs)

  • Secondary purification using size exclusion chromatography

  • Concentration determination via BCA or Bradford assay

Storage of the purified protein should follow established guidelines: aliquot in Tris-based buffer with 50% glycerol and store at -20°C for short-term use or -80°C for extended storage . Repeated freeze-thaw cycles significantly reduce protein activity, so working aliquots should be maintained at 4°C for up to one week. When designing expression constructs, researchers should carefully consider the inclusion of the chloroplast transit peptide, as this may affect expression efficiency and downstream applications.

What are the optimal conditions for conducting ELISA assays with GDT1-like protein 1?

When performing ELISA assays with recombinant GDT1-like protein 1, several methodological considerations are critical for reliable results. The optimal coating buffer for this protein is typically carbonate-bicarbonate buffer at pH 9.6, which facilitates protein adsorption to the plate surface. Coating should be performed overnight at 4°C with a protein concentration ranging from 1-5 μg/ml.

For blocking, a 3-5% BSA solution in PBS-Tween (0.05%) generally provides the best results with minimal background. Antibody dilutions should be optimized through preliminary experiments, but a starting range of 1:500-1:2000 for primary antibodies and 1:2000-1:5000 for enzyme-conjugated secondary antibodies is recommended. Development time varies based on substrate choice, but monitoring absorbance at regular intervals prevents signal saturation.

Temperature control during incubation steps is particularly important for this protein, with consistent 37°C recommended for antibody binding steps. Researchers should include both positive and negative controls in each assay, and standards prepared from the same recombinant protein batch should be used to generate a reliable standard curve. For quantitative applications, a four-parameter logistic curve fitting typically provides the most accurate concentration calculations from absorbance readings.

How can GDT1-like protein 1 function be studied through knockout or knockdown approaches?

Investigating GDT1-like protein 1 function through knockout or knockdown approaches requires strategic experimental design. CRISPR/Cas9-mediated gene editing represents the most efficient method for generating complete knockout lines in rice. When designing guide RNAs for Os01g0221700, researchers should target exon regions that encode functional domains, ideally within the first half of the coding sequence to ensure complete loss of function. Multiple guide RNAs (at least 2-3) should be designed and validated for specificity using tools like CRISPR-P 2.0 or CRISPOR.

For knockdown studies, RNA interference (RNAi) or virus-induced gene silencing (VIGS) offers greater flexibility, especially when studying developmentally critical genes. When designing RNAi constructs, target sequences of 300-500bp with high specificity to GDT1-like protein 1 should be selected, avoiding regions with homology to other GDT1 family members to prevent off-target effects.

Phenotypic analysis of transgenic lines should include:

  • Molecular characterization (PCR, RT-qPCR, Western blot)

  • Developmental phenotyping (growth rate, chlorophyll content, photosynthetic efficiency)

  • Stress response assays (drought, salinity, temperature extremes)

  • Cellular calcium transport analysis

  • Chloroplast morphology and function assessment

Complementation assays, where the wild-type gene is reintroduced into knockout lines, are essential to confirm that observed phenotypes result from GDT1-like protein 1 disruption rather than off-target effects or somaclonal variation. Additionally, conditional knockout systems using inducible promoters may help overcome lethality issues if the gene proves essential for plant viability.

What approaches are recommended for studying protein-protein interactions involving GDT1-like protein 1?

For studying protein-protein interactions involving GDT1-like protein 1, researchers should implement a multi-technique approach to overcome challenges associated with membrane-bound proteins. Yeast two-hybrid (Y2H) systems, while useful for soluble proteins, may yield false negatives with transmembrane proteins like GDT1-like protein 1. Instead, modified membrane-based Y2H systems such as split-ubiquitin Y2H are more appropriate.

Co-immunoprecipitation (Co-IP) represents a robust technique for detecting in vivo interactions. When performing Co-IP with GDT1-like protein 1:

  • Use mild detergents (0.5-1% NP-40 or digitonin) for membrane solubilization

  • Include protease inhibitor cocktails to prevent degradation

  • Pre-clear lysates with protein A/G beads to reduce non-specific binding

  • Perform parallel negative controls using non-specific antibodies or pre-immune serum

Bimolecular Fluorescence Complementation (BiFC) offers visualization of protein interactions in plant cells and is particularly useful for determining subcellular localization of interactions. For BiFC with GDT1-like protein 1, fusions should be created with split YFP/GFP fragments, with careful attention to linker length (10-15 amino acids recommended) between the protein and fluorescent fragment.

Proximity-based labeling methods such as BioID or TurboID are emerging as powerful approaches for identifying transient or weak interactions common in signaling pathways. These techniques involve fusion of a biotin ligase to GDT1-like protein 1, allowing biotinylation of proximal proteins that can later be purified and identified by mass spectrometry.

How does post-translational modification affect GDT1-like protein 1 function and what methods can detect these modifications?

Post-translational modifications (PTMs) of GDT1-like protein 1 likely play critical roles in regulating its localization, activity, and protein-protein interactions. Based on sequence analysis and comparison with similar proteins, GDT1-like protein 1 may undergo phosphorylation, particularly at serine and threonine residues within cytosolic domains. These modifications often occur in response to environmental stressors or developmental cues.

To detect and characterize PTMs in GDT1-like protein 1, researchers should employ:

  • Phosphorylation analysis: Use Phos-tag™ SDS-PAGE followed by Western blotting to detect mobility shifts caused by phosphorylation. For site-specific identification, immunoprecipitated protein should undergo tryptic digestion and phosphopeptide enrichment (using TiO₂ or IMAC) prior to LC-MS/MS analysis.

  • Ubiquitination detection: Immunoprecipitate GDT1-like protein 1 using specific antibodies, followed by Western blotting with anti-ubiquitin antibodies. Alternatively, tandem ubiquitin binding entities (TUBEs) can enrich ubiquitinated forms prior to analysis.

  • Glycosylation assessment: Treat protein samples with glycosidases (PNGase F or Endo H) and observe mobility shifts on SDS-PAGE. For detailed glycan structure analysis, released glycans can be analyzed by MALDI-TOF MS.

PTM site mutagenesis represents a powerful approach to determine functional significance. Key residues identified by mass spectrometry should be mutated to either mimic the modification (e.g., S→D for phosphorylation) or prevent it (S→A). Expressing these variants in knockout backgrounds allows assessment of their impact on protein function, subcellular localization, and plant phenotype.

What is the evolutionary relationship between rice GDT1-like protein 1 and homologs in other plant species?

GDT1-like protein 1 in Oryza sativa belongs to a conserved family of membrane proteins found across plant species, with varying degrees of sequence conservation. Comprehensive phylogenetic analysis reveals closest homology with other monocot species, particularly those within the Poaceae family, while showing greater divergence from dicot homologs.

To conduct a robust evolutionary analysis of GDT1-like protein 1, researchers should:

  • Retrieve homologous sequences from genomic databases using BLASTP/TBLASTN searches

  • Perform multiple sequence alignment using MUSCLE or MAFFT algorithms with refinement through Gblocks

  • Construct phylogenetic trees using maximum likelihood methods (RAxML or IQ-TREE) with appropriate substitution models

  • Calculate evolutionary rates and selection pressures using PAML or HyPhy

Comparative domain analysis shows that the transmembrane topology is highly conserved across species, while N-terminal regions display greater variability. The chloroplast transit peptide in particular shows lower sequence conservation despite maintained functionality, characteristic of transit peptide evolution. Key functional domains can be identified by patterns of purifying selection (low dN/dS ratios) across species.

Homology modeling using AlphaFold or similar tools can provide structural insights when comparing GDT1-like protein 1 across species. These models should be evaluated for conservation of putative ion binding sites and membrane interfaces, which often indicate functional importance across evolutionary distance.

What methodologies are most effective for analyzing GDT1-like protein 1 expression under different stress conditions?

Analyzing GDT1-like protein 1 expression under stress conditions requires a multifaceted approach combining transcriptional, translational, and post-translational analysis. For transcriptional analysis, RT-qPCR remains the gold standard when properly designed and executed. Primers should target unique regions of Os01g0221700 with verification of specificity through melt curve analysis and sequencing of amplicons.

Reference gene selection is critical for accurate normalization; a combination of at least three stable reference genes (e.g., OsUBQ, OsACT, OsEF-1α) should be validated under each specific stress condition using geNorm or NormFinder algorithms. For relative quantification, the 2^(-ΔΔCt) method with efficiency correction provides reliable results when PCR efficiencies fall between 90-110%.

Protein-level analysis through Western blotting requires careful optimization for membrane proteins like GDT1-like protein 1. Extraction buffers containing 2% SDS or 8M urea effectively solubilize membrane proteins, while transfer conditions (semi-dry vs. wet transfer) should be optimized for high molecular weight transmembrane proteins. Due to potential low abundance, enhanced chemiluminescence or fluorescent detection systems offer greater sensitivity than colorimetric methods.

For high-throughput analysis, RNA-Seq provides comprehensive transcriptome data but requires careful experimental design:

ConsiderationRecommendation
Biological replicatesMinimum 3, preferably 4-5
Sequencing depth20-30 million paired-end reads per sample
Library preparationStranded mRNA library to distinguish antisense transcription
Analysis pipelineHISAT2 for alignment, StringTie for transcript assembly, DESeq2 for differential expression
Time pointsMultiple (early, middle, late) to capture dynamic responses

Integration of these methodologies provides a comprehensive view of GDT1-like protein 1 regulation under stress conditions, from transcriptional changes to protein accumulation and modification.

How can GDT1-like protein 1 research contribute to crop improvement strategies?

GDT1-like protein 1 research offers several promising avenues for crop improvement, particularly in developing stress-tolerant rice varieties. As a chloroplast-localized protein potentially involved in ion homeostasis, GDT1-like protein 1 may contribute to photosynthetic efficiency and abiotic stress tolerance. Translational research approaches should focus on several key strategies.

Marker-assisted selection (MAS) represents the most straightforward application. By identifying natural allelic variations in Os01g0221700 associated with desirable traits, breeders can develop molecular markers for accelerated selection. This approach requires extensive phenotyping of diverse rice germplasm under controlled stress conditions, coupled with genotyping to identify significant marker-trait associations.

Genetic engineering approaches include modifying GDT1-like protein 1 expression levels or protein structure. Overexpression under constitutive promoters may enhance stress tolerance, while tissue-specific or stress-inducible promoters can minimize yield penalties. CRISPR/Cas-mediated base editing offers precision modification of specific amino acids identified as functionally significant through structure-function studies.

For implementing these approaches, researchers should consider:

Additionally, researchers should investigate potential synergistic effects when combining GDT1-like protein 1 modifications with other genes involved in stress response pathways, as multigenic approaches often provide more robust and durable stress tolerance.

What are the best methods for conducting structure-function analysis of GDT1-like protein 1?

Structure-function analysis of GDT1-like protein 1 requires integrating computational prediction with experimental validation. For computational structure prediction, AlphaFold2 or RoseTTAFold provide state-of-the-art accuracy for membrane proteins. These models should be refined using molecular dynamics simulations in explicit membrane environments to assess stability and identify potential ion conduction pathways.

Domain swapping experiments represent a powerful approach for functional mapping. By creating chimeric proteins where domains from GDT1-like protein 1 are exchanged with homologous regions from related proteins with different functions, researchers can identify domains responsible for specific activities. These constructs should be expressed in knockout backgrounds to assess functional complementation.

Site-directed mutagenesis targeting conserved residues identified through evolutionary analysis or computational prediction provides fine-grained functional insights. Priority should be given to:

  • Charged residues within transmembrane domains (potentially involved in ion transport)

  • Highly conserved residues across species

  • Residues predicted to form binding pockets or transport channels

  • Sites of post-translational modification

For each mutant, functional assessment should include:

Analysis TypeMethodologyParameters Measured
LocalizationConfocal microscopyTargeting efficiency to chloroplasts
Ion transportLiposome-based assaysTransport kinetics, ion selectivity
Protein stabilityPulse-chase analysisProtein half-life in vivo
Interaction profileCo-IP followed by MSChanges in interaction partners
Plant phenotypePhenotypic analysisGrowth, stress tolerance, photosynthetic parameters

Researchers should note that membrane proteins present particular challenges for structural studies. While X-ray crystallography remains challenging for plant membrane proteins, cryo-electron microscopy (cryo-EM) offers promising alternatives when sufficient quantities of pure, stable protein can be obtained.

What quality control measures are essential when working with recombinant GDT1-like protein 1?

Ensuring high quality recombinant GDT1-like protein 1 requires rigorous quality control at multiple stages. Upon receiving commercial recombinant protein or after in-house purification, researchers should verify several critical parameters before proceeding with experiments.

Purity assessment through SDS-PAGE with Coomassie or silver staining should demonstrate >90% purity for most applications, with a single band at the expected molecular weight (approximately 38 kDa for the mature protein without the transit peptide). Western blotting using anti-GDT1 or anti-tag antibodies confirms protein identity and integrity. For membrane proteins like GDT1-like protein 1, slight differences in apparent molecular weight from the calculated value are common due to detergent binding.

Protein concentration determination should employ multiple methods for verification:

  • Absorbance at 280 nm (A280) using the theoretical extinction coefficient

  • BCA or Bradford assay with BSA standards

  • Amino acid analysis for absolute quantification when highest accuracy is required

Functional verification depends on the application but may include:

  • Circular dichroism spectroscopy to confirm secondary structure

  • Limited proteolysis to assess proper folding

  • Thermal shift assays to determine protein stability

  • Specific binding assays if ligands/substrates are known

Long-term stability monitoring is essential, with aliquots stored under recommended conditions (Tris-based buffer with 50% glycerol at -20°C) tested at regular intervals. For critical experiments, researchers should prepare fresh working dilutions from frozen stocks and avoid using preparations subjected to multiple freeze-thaw cycles, as this significantly impacts protein activity.

How should researchers address data inconsistencies in GDT1-like protein 1 experiments?

When encountering data inconsistencies in experiments involving GDT1-like protein 1, researchers should implement a systematic troubleshooting approach rather than discarding apparently contradictory results. Inconsistencies often reveal important biological insights or methodological limitations that require careful analysis.

First, researchers should evaluate experimental variables that may contribute to inconsistencies:

  • Protein quality and batch variation (check purity, integrity via Western blot)

  • Buffer composition effects (pH, ionic strength, detergent concentration)

  • Temperature fluctuations during assays

  • Time-dependent effects (protein stability over experimental duration)

  • Cellular context differences (expression system, background genotype)

For transcriptional analysis inconsistencies, verify primer specificity to exclude amplification of related GDT1 family members. Rice contains multiple GDT1-like proteins that share sequence similarity, potentially causing cross-reactivity in PCR or antibody-based detection methods. Similarly, antibody specificity should be validated through appropriate controls, including knockout lines where available.

Statistical analysis plays a critical role in evaluating apparent inconsistencies. Power analysis should be performed to ensure sufficient sample sizes, and appropriate statistical tests should be selected based on data distribution. When combining data from multiple experiments, mixed-effects models that account for batch effects often provide more accurate analysis than simple pooling.

Publication or presentation of seemingly inconsistent results should include detailed methodology and open discussion of variables that may influence outcomes. This transparency not only maintains scientific integrity but often advances understanding of complex biological systems where context-dependent functions are common.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.