Recombinant Oryza sativa subsp. japonica GDT1-like protein 2, chloroplastic (Os11g0544500, LOC_Os11g34180)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format that we currently have in stock. However, if you have specific format requirements, please indicate them in your order. We will fulfill your request to the best of our ability.
Lead Time
Delivery time may vary depending on the purchase method and location. Please contact your local distributor for specific delivery details.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer composition, temperature, and the intrinsic stability of the protein.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The shelf life of the lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
The tag type will be determined during production. If you have specific tag type requirements, please inform us, and we will prioritize developing the specified tag.
Synonyms
Os11g0544500; LOC_Os11g34180; OsJ_34180; GDT1-like protein 2, chloroplastic
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
13-347
Protein Length
Full Length of Mature Protein
Species
Oryza sativa subsp. japonica (Rice)
Target Names
Os11g0544500
Target Protein Sequence
AASRRREDGAGPPLLLRRRCLVEGQVRCRLPWLRPIRHNVRVQTSNVNVGAGSYEGGEAG SHGEHLDSSATRDSNKPTKPPSGSRYPQSIAAVLLLCALASAFIVFFKGQPSAVVAMLAK SGFTAAFTLIFVSEIGDKTFFIAALLAMQYQRALVLLGSMAALSLMTIVSVIIGRIFQSV PAQFQTTLPIGEYAAIALLAFFGFKSIKDAWQLPDNANGNLQGNSESGELAEAEELVKEK VAKKLTSPLEVLWKSFSLVFFAEWGDRSMLATIALGAAQSPFGVASGAIAGHLVATFLAI VGGAFLANYLSEKLVGLIGGVLFLLFAVATFFGVF
Uniprot No.

Target Background

Database Links

KEGG: osa:4350683

UniGene: Os.9476

Protein Families
GDT1 family
Subcellular Location
Plastid, chloroplast membrane; Multi-pass membrane protein.

Q&A

What is GDT1-like protein 2 in Oryza sativa and what family does it belong to?

GDT1-like protein 2 from Oryza sativa subsp. japonica is a chloroplastic membrane protein belonging to the GDT1 family (formerly known as UPF0016 or Uncharacterized Protein Family 0016). This protein family contains members that are well conserved throughout evolution in eukaryotes, bacteria, and archaea. The defining characteristic of this family is the presence of one or two copies of the consensus motif Glu-x-Gly-Asp-(Arg/Lys)-(Ser/Thr). These proteins function as transporters of cations, particularly manganese (Mn²⁺), with some members also involved in calcium (Ca²⁺) and/or proton (H⁺) transport .

What is the predicted subcellular localization of GDT1-like protein 2 and how does this relate to its function?

GDT1-like protein 2 is predicted to be chloroplastic, as indicated by its name. This localization suggests a role in chloroplast membrane transport processes. By analogy to other GDT1 family members, which are found in various cellular compartments (Golgi membrane in humans and yeast, chloroplast membranes in plants, thylakoid and plasma membranes in cyanobacteria), the chloroplastic localization of this protein indicates a likely function in maintaining ion homeostasis within the chloroplast. This is particularly relevant for photosynthesis, where proper ion balance, especially of divalent cations like Mn²⁺ (essential for the oxygen-evolving complex) and Ca²⁺ (involved in signaling), is critical for chloroplast function .

What are the optimal conditions for recombinant expression of GDT1-like protein 2 in E. coli?

For successful recombinant expression of GDT1-like protein 2 in E. coli, the following conditions are recommended:

  • Expression System: E. coli with N-terminal His-tag fusion

  • Expression Vector: pET-based vectors with T7 promoter are commonly used for membrane proteins

  • Induction Parameters:

    • Temperature: 16-18°C (lower temperatures reduce inclusion body formation)

    • IPTG concentration: 0.1-0.5 mM

    • Induction time: 16-20 hours

  • Cell Lysis Buffer:

    • 50 mM Tris-HCl pH 8.0

    • 150-300 mM NaCl

    • 10% glycerol

    • Protease inhibitors

  • Purification Strategy:

    • Immobilized metal affinity chromatography (IMAC) using the His-tag

    • Followed by size exclusion chromatography

The purified protein should be stored in a Tris/PBS-based buffer with 6% trehalose at pH 8.0. For long-term storage, addition of glycerol (final concentration 5-50%, with 50% being optimal) and storage at -20°C/-80°C in aliquots is recommended to prevent repeated freeze-thaw cycles .

How can researchers verify the functional activity of purified recombinant GDT1-like protein 2?

To verify the functional activity of purified recombinant GDT1-like protein 2, researchers should employ multiple complementary approaches:

  • Transport Assays:

    • Reconstitution into proteoliposomes for direct measurement of Mn²⁺ and/or Ca²⁺ transport

    • Fluorescent indicator-based assays using calcium-sensitive (Fura-2) or manganese-quenchable fluorophores

    • Radioisotope (⁴⁵Ca, ⁵⁴Mn) uptake experiments

  • Binding Assays:

    • Isothermal titration calorimetry (ITC) to determine binding affinities for various cations

    • Microscale thermophoresis (MST) for interaction studies

  • Complementation Studies:

    • Functional complementation of yeast gdt1Δ mutants, which display calcium sensitivity

    • Rescue of phenotypes in rice or Arabidopsis mutants lacking functional GDT1 homologs

  • Structural Integrity Confirmation:

    • Circular dichroism (CD) spectroscopy to verify proper secondary structure

    • Limited proteolysis to assess folding quality

    • Thermal shift assays to evaluate protein stability

The combination of these methods provides comprehensive evidence for the functional integrity of the recombinant protein .

What techniques are available for studying protein-protein interactions involving GDT1-like protein 2?

Several techniques can be employed to study protein-protein interactions involving GDT1-like protein 2:

  • Co-immunoprecipitation (Co-IP):

    • Utilizing the His-tag or specific antibodies against GDT1-like protein 2

    • Western blotting to identify interacting partners

  • Yeast Two-Hybrid (Y2H):

    • Split-ubiquitin Y2H specialized for membrane proteins

    • Allows screening of interaction partners in a cellular context

  • Bimolecular Fluorescence Complementation (BiFC):

    • In planta visualization of protein interactions

    • Can confirm localization while demonstrating interaction

  • Förster Resonance Energy Transfer (FRET):

    • Label GDT1-like protein 2 and potential partners with compatible fluorophores

    • Detect interaction through energy transfer between fluorophores

  • Surface Plasmon Resonance (SPR):

    • Real-time kinetic measurements of protein-protein interactions

    • Requires purified components

  • Proximity-dependent Biotin Identification (BioID):

    • Fusion of GDT1-like protein 2 with a biotin ligase

    • Identification of proximal proteins in the native cellular environment

  • Crosslinking Mass Spectrometry:

    • Chemical crosslinking followed by mass spectrometry identification

    • Captures transient interactions and provides structural information

For membrane proteins like GDT1-like protein 2, detergent selection is critical in maintaining protein integrity during these studies .

What metabolic pathways might involve GDT1-like protein 2 in rice chloroplasts?

GDT1-like protein 2 in rice chloroplasts likely participates in several key metabolic pathways through its role in cation homeostasis:

  • Photosynthetic Electron Transport:

    • Manganese is essential for the oxygen-evolving complex (OEC) of photosystem II

    • Proper Mn²⁺ supply to the OEC is critical for photosynthetic efficiency

    • GDT1-like protein 2 may facilitate Mn²⁺ transport across chloroplast membranes

  • Calvin-Benson Cycle Regulation:

    • Many Calvin-Benson cycle enzymes require proper ionic conditions for optimal activity

    • GDT1-like protein 2 could indirectly influence carbon fixation through ion homeostasis

  • Chloroplast Redox Signaling:

    • Ca²⁺ serves as a secondary messenger in chloroplast signaling pathways

    • GDT1-like protein 2 may contribute to Ca²⁺ flux regulation between chloroplast compartments

  • Photoprotection Mechanisms:

    • Ion balance affects thylakoid lumen pH and energy-dependent quenching

    • GDT1-like protein 2 could influence photoprotection through membrane transport activities

These pathways are interconnected within rice metabolism and can be analyzed using genome-scale metabolic models (GEMs) such as iOS2164, which provides the most comprehensive coverage of rice metabolism among existing models .

How might GDT1-like protein 2 function differ from other chloroplastic transporters in rice?

GDT1-like protein 2 function can be differentiated from other chloroplastic transporters in rice based on several criteria:

TransporterPrimary SubstratesLocalizationRole in PhotosynthesisPhenotypes in Knockouts
GDT1-like protein 2Mn²⁺, possibly Ca²⁺, H⁺Chloroplast membranesCation homeostasis, likely affecting photosystem IIPredicted: reduced photosynthetic efficiency
OsPLGG1Glycolate, glycerateChloroplast envelopePhotorespiratory metabolite transportSevere growth retardation, pale-green leaves, reduced photosynthesis, rescued by high CO₂
OsPLGG2Unknown (non-functional homolog)UnknownNone identifiedNo visible phenotype
Chloroplastic calcium transportersCa²⁺Chloroplast envelopeCalcium signaling, stress responsesVariable photosynthetic phenotypes
Chloroplastic manganese transportersMn²⁺Thylakoid membrane, chloroplast envelopeAssembly and function of PS IIPhotosystem II deficiency

The functional specificity of GDT1-like protein 2 likely involves unique regulatory mechanisms or kinetic properties that distinguish it from other transporters. Unlike OsPLGG1, which specifically transports photorespiratory metabolites, GDT1-like protein 2 is expected to focus on ionic homeostasis. This distinction is particularly significant in rice, a C3 plant where both photosynthesis and photorespiration are important metabolic processes .

What phenotypes might be expected in rice plants with mutations in the gene encoding GDT1-like protein 2?

Based on comparative analysis with related transporters and GDT1 family members in other organisms, rice plants with mutations in the gene encoding GDT1-like protein 2 would likely exhibit the following phenotypes:

  • Photosynthetic Deficiencies:

    • Reduced photosystem II efficiency (lower Fv/Fm)

    • Decreased effective photochemical quantum yield of PS II and PS I

    • Increased sensitivity to photoinhibition

    • Pale-green leaf coloration

  • Growth and Development Abnormalities:

    • Stunted growth similar to that observed in osplgg1 mutants

    • Reduced tillering and lower grain weight

    • Delayed development milestones

  • Metabolic Alterations:

    • Accumulation of manganese in specific cellular compartments

    • Disrupted calcium homeostasis

    • Altered response to oxidative stress

  • Conditional Phenotypes:

    • More severe symptoms under high light conditions

    • Partial rescue under high CO₂ conditions if photosynthesis is affected

    • Exacerbated phenotypes under manganese-limited conditions

  • Molecular Signatures:

    • Upregulation of alternative transport mechanisms

    • Altered expression of manganese-dependent enzymes

    • Compensatory changes in ion transport systems

The severity of these phenotypes might vary depending on the nature of the mutation (knockout vs. partial loss-of-function) and environmental conditions, particularly light intensity and manganese availability .

How can computational modeling be used to predict the transport mechanism of GDT1-like protein 2?

Computational modeling of GDT1-like protein 2 transport mechanisms can employ multiple approaches to yield complementary insights:

  • Homology Modeling and Molecular Dynamics:

    • Construct 3D structural models based on known structures of related transporters

    • Simulate protein dynamics in a lipid bilayer environment

    • Identify potential ion binding sites using electrostatic potential mapping

    • Example command: gmx mdrun -deffnm GDT1_protein_membrane -v

  • Quantum Mechanics/Molecular Mechanics (QM/MM):

    • Model the electronic properties of the ion binding sites

    • Calculate energy barriers for ion translocation

    • Equation for binding energy calculation:
      ΔGbinding=ΔHTΔS\Delta G_{binding} = \Delta H - T\Delta S

  • Systems Biology Approaches:

    • Integrate GDT1-like protein 2 into genome-scale metabolic models like iOS2164

    • Predict flux distributions under various conditions

    • Simulate knockout effects on rice metabolism

  • Markov State Modeling:

    • Identify metastable states during transport cycle

    • Quantify transition probabilities between states

    • Predict rate-limiting steps in transport mechanism

  • Electrophysiological Data Integration:

    • Develop kinetic models based on experimental electrophysiology

    • Predict transport rates under various ion concentrations and membrane potentials

    • Fit models to experimental data to refine parameters

These computational approaches can generate testable hypotheses about the alternating access mechanism, ion selectivity determinants, and regulatory features of GDT1-like protein 2 .

What strategies can be employed to improve the stability and solubility of recombinant GDT1-like protein 2 for structural studies?

Improving stability and solubility of recombinant GDT1-like protein 2 for structural studies requires a multi-faceted approach:

  • Construct Optimization:

    • Truncation analysis to remove disordered regions

    • Fusion with solubility-enhancing tags (MBP, SUMO, Trx)

    • Introduction of stabilizing mutations based on evolutionary analysis

    • Synthetic gene design with codon optimization for E. coli

  • Expression Conditions:

    • Specialized E. coli strains (C41/C43, Lemo21)

    • Co-expression with chaperones (GroEL/ES, DnaK/J/GrpE)

    • Slow expression rates (low temperature, reduced inducer)

    • Addition of specific ligands during expression

  • Extraction and Purification:

    • Screening detergent panels (DDM, LMNG, GDN)

    • Lipid supplementation during solubilization

    • Addition of specific ions (Mn²⁺, Ca²⁺) during purification

    • Buffer optimization with stabilizing additives

  • Alternative Approaches:

    • Reconstitution into nanodiscs or SMALPs

    • Amphipol exchange for detergent-free handling

    • Lipidic cubic phase crystallization

    • In meso crystallization techniques

A systematic stability assessment should be performed using thermal shift assays (TSA) and size-exclusion chromatography coupled with multi-angle light scattering (SEC-MALS) to identify optimal conditions. For structural studies specifically, protein engineering to introduce surface mutations that promote crystal contacts may be necessary, while maintaining the functional core of the protein .

How can CRISPR/Cas9 genome editing be designed to study GDT1-like protein 2 function in vivo?

A comprehensive CRISPR/Cas9 strategy to study GDT1-like protein 2 function in rice involves:

  • Target Site Selection:

    • Guide RNA design targeting exonic regions of Os11g0544500

    • Multiple gRNAs targeting different exons to ensure knockout

    • Off-target analysis using CRISPOR or similar tools

  • Vector Construction:

    • Binary vector containing Cas9 optimized for monocots

    • Rice-specific promoters (OsUbiquitin) for Cas9 expression

    • Individual U3/U6 promoters for each gRNA

    • Selectable marker (Hygromycin/Basta resistance)

  • Transformation and Screening:

    • Agrobacterium-mediated transformation of rice callus

    • Regeneration under selection pressure

    • PCR-based genotyping of T0 plants

    • Sequencing confirmation of mutations

  • Alternative Modification Strategies:

    • Knock-in of fluorescent tags for localization studies

    • Base editing for specific amino acid substitutions

    • Promoter replacement for expression modulation

    • Inducible CRISPR interference for temporal control

  • Phenotypic Analysis:

    • Comparison of normal vs. high CO₂ growth conditions

    • Photosynthetic parameter measurements (similar to osplgg1 studies)

    • Manganese and calcium content analysis

    • Transcriptomic and metabolomic profiling

This approach allows for comprehensive functional characterization in the native context, with the potential to generate knockout, knockdown, and tagged variants for different experimental purposes .

How do rice GDT1-like proteins compare structurally and functionally with their homologs in other plant species?

Comparative analysis of rice GDT1-like proteins with homologs in other plant species reveals both conservation and divergence:

SpeciesProteinSequence Identity to OsGDT1-like protein 2LocalizationFunctionPhenotype in Mutants
Rice (Oryza sativa)GDT1-like protein 2100%ChloroplasticCation transport (predicted)Not characterized
Arabidopsis thalianaPAM71~60-65%Chloroplast thylakoid membraneMn²⁺ transportPhotosystem II deficiency
Arabidopsis thalianaCMT1~50-55%Chloroplast envelopeMn²⁺ transportMn²⁺ homeostasis disruption
Maize (Zea mays)GDT1-like homolog~85-90%Predicted chloroplasticNot characterizedNot characterized
Chlamydomonas reinhardtiiPAM71 homolog~40-45%Thylakoid membraneMn²⁺ transportPhotosynthetic defects

Key structural features conserved across species include:

  • The signature motifs Glu-x-Gly-Asp-(Arg/Lys)-(Ser/Thr)

  • Predicted transmembrane domains

  • Chloroplastic targeting sequences (with species-specific variations)

Functional divergence is observed in:

  • Substrate specificity (some primarily transport Mn²⁺, others have broader specificity)

  • Regulatory mechanisms

  • Integration with species-specific metabolic networks

Evolutionary analysis suggests that plant GDT1-like proteins diverged to fulfill specialized roles in photosynthetic organisms, with increasing complexity and specialization in higher plants compared to algae and cyanobacteria .

What insights from yeast and human GDT1 family proteins can be applied to understanding the rice homolog?

Research on yeast and human GDT1 family proteins provides valuable insights that can be translated to the rice homolog:

  • From Yeast Gdt1p Studies:

    • Genetic interaction between Gdt1p and PMR1 (P-type ATPase) suggests functional complementarity

    • Ca²⁺ homeostasis role in the Golgi apparatus

    • Stress response regulation

    • Transport mechanism involving counter-ion exchange

    • These findings suggest investigating similar genetic interactions in rice, particularly with P-type ATPases

  • From Human TMEM165 Studies:

    • Link to Congenital Disorders of Glycosylation when mutated

    • Essential role in glycosylation processes

    • Importance in lactation

    • Dual transport capacity for Ca²⁺ and Mn²⁺

    • These connections suggest examining the role of rice GDT1-like protein 2 in glycosylation of chloroplastic proteins

  • Translatable Methodologies:

    • Complementation assays in yeast gdt1Δ mutants can test rice protein function

    • CRISPR/Cas9 approaches similar to those used in human cell studies

    • Transport assays developed for human/yeast proteins

    • Structural analysis approaches from solved structures

  • Evolutionary Insights:

    • Conservation of GDT1 function across species suggests fundamental importance

    • Divergent cellular localizations indicate adaptation to organism-specific requirements

    • Common ancestry but specialized functions in different organisms

  • Therapeutic Relevance:

    • Understanding plant GDT1 proteins could inform treatments for human TMEM165-related disorders

    • Potential agricultural applications for improving plant stress resistance

The comparative approach leveraging knowledge from diverse organisms can accelerate understanding of the rice GDT1-like protein 2 function and provide evolutionary context for its role .

What are the common difficulties encountered when working with recombinant membrane proteins like GDT1-like protein 2, and how can they be addressed?

Working with recombinant membrane proteins like GDT1-like protein 2 presents several technical challenges that require specific solutions:

  • Low Expression Yields:

    • Challenge: Membrane protein overexpression often toxic to host cells

    • Solutions:

      • Use specialized E. coli strains (C41/C43, Lemo21)

      • Employ tightly controlled induction systems

      • Optimize codon usage for expression host

      • Consider alternative expression systems (insect cells, yeast)

  • Protein Misfolding and Aggregation:

    • Challenge: Membrane proteins prone to form inclusion bodies

    • Solutions:

      • Express at lower temperatures (16-18°C)

      • Co-express with molecular chaperones

      • Add chemical chaperones to culture medium

      • Fine-tune inducer concentration and induction time

  • Extraction and Solubilization Issues:

    • Challenge: Selecting appropriate detergents for extraction

    • Solutions:

      • Screen detergent panels (mild vs. harsh)

      • Use high-throughput stability assays to identify optimal detergents

      • Consider native nanodiscs or styrene-maleic acid copolymer lipid particles (SMALPs)

      • Include stabilizing additives (glycerol, specific ions)

  • Purification Difficulties:

    • Challenge: Maintaining stability during purification steps

    • Solutions:

      • Minimize purification steps

      • Include critical ions (Mn²⁺, Ca²⁺) in purification buffers

      • Maintain detergent above critical micelle concentration

      • Consider on-column detergent exchange

  • Functional Characterization Challenges:

    • Challenge: Assessing function outside native membrane environment

    • Solutions:

      • Reconstitute into proteoliposomes or nanodiscs

      • Develop solid-supported membrane electrophysiology assays

      • Use fluorescence-based transport assays

      • Implement in vivo complementation tests

A systematic approach addressing these challenges can significantly improve the chances of obtaining functional recombinant GDT1-like protein 2 for structural and functional studies .

How can researchers troubleshoot experiments when unexpected results arise in GDT1-like protein 2 studies?

When facing unexpected results in GDT1-like protein 2 research, a structured troubleshooting approach is essential:

  • Protein Expression Problems:

    • Symptom: Low or no detectable expression

    • Troubleshooting steps:

      • Verify plasmid sequence integrity

      • Test multiple growth media compositions

      • Try different host strains

      • Examine expression at multiple time points

      • Check for toxic effects on host cells

    • Diagnostic tools: Western blot, growth curves, microscopy

  • Purification Issues:

    • Symptom: Multiple bands or degradation products

    • Troubleshooting steps:

      • Add protease inhibitors during all steps

      • Reduce handling time and temperature

      • Try different buffer conditions

      • Optimize detergent concentration

      • Consider mild solubilization conditions

    • Diagnostic tools: SDS-PAGE, mass spectrometry, N-terminal sequencing

  • Activity Assay Inconsistencies:

    • Symptom: Variable or no detectable activity

    • Troubleshooting steps:

      • Verify protein integrity by circular dichroism

      • Control for detergent interference in assays

      • Test multiple assay formats

      • Include positive controls

      • Consider protein orientation in reconstituted systems

    • Diagnostic tools: Transport assays, binding assays, structural integrity tests

  • Crystallization Failures:

    • Symptom: No crystal formation or poor diffraction

    • Troubleshooting steps:

      • Assess protein homogeneity by SEC-MALS

      • Screen additional detergents and additives

      • Try lipidic cubic phase crystallization

      • Consider protein engineering to improve crystallizability

      • Explore alternative structural biology methods (cryo-EM, NMR)

    • Diagnostic tools: Dynamic light scattering, thermal stability assays, crystallization screening

  • In Vivo Phenotypic Discrepancies:

    • Symptom: Unexpected phenotypes in mutant plants

    • Troubleshooting steps:

      • Confirm mutation by sequencing

      • Check for off-target effects

      • Analyze potential genetic compensation

      • Test under varied environmental conditions

      • Perform complementation studies

    • Diagnostic tools: PCR genotyping, RNA-Seq, metabolomics, microscopy

Documenting all experimental conditions and maintaining detailed laboratory records is crucial for effective troubleshooting and reproducibility in membrane protein research .

What are the best practices for maintaining protein stability during structural and functional studies of recombinant GDT1-like protein 2?

Maintaining protein stability during structural and functional studies of recombinant GDT1-like protein 2 requires comprehensive optimization of conditions:

  • Purification and Storage Considerations:

    • Use freshly purified protein whenever possible

    • Store at appropriate temperature (-80°C for long-term)

    • Add 6% trehalose to storage buffer

    • Add glycerol (recommended final concentration 50%)

    • Aliquot to avoid repeated freeze-thaw cycles

    • Maintain pH at optimal level (pH 8.0 recommended)

  • Buffer Composition Guidelines:

    • ComponentRecommended RangePurpose
      BufferTris or PBS-basedMaintains pH
      NaCl150-300 mMPrevents non-specific interactions
      Glycerol5-10%Stabilizes protein structure
      Reducing agent1-5 mM DTT or TCEPPrevents oxidation
      Protease inhibitorsAs recommendedPrevents degradation
      Specific ions1-5 mM Mn²⁺/Ca²⁺Stabilizes transport function
  • Detergent Selection Criteria:

    • Test multiple detergents: DDM, LMNG, GDN, CHAPS

    • Use detergent concentrations slightly above CMC

    • Consider mixed micelle systems (detergent + lipid)

    • Evaluate detergent effects on protein activity

  • Advanced Stabilization Approaches:

    • Lipid supplementation with chloroplast lipids

    • Nanodiscs for detergent-free environments

    • Addition of specific binding partners or substrates

    • Thermostabilizing mutations identified through screening

  • Monitoring Stability:

    • Regular quality checks using SEC

    • Thermal shift assays to evaluate stabilizing conditions

    • Limited proteolysis to assess structural integrity

    • Activity assays to confirm functional stability

Following these best practices significantly increases the likelihood of maintaining GDT1-like protein 2 in its native conformation throughout experimental procedures. For reconstitution experiments, incorporating specific lipids found in the chloroplast membrane can further enhance stability and functional preservation .

What are the most promising approaches for determining the high-resolution structure of GDT1-like protein 2?

Determining the high-resolution structure of GDT1-like protein 2 presents unique challenges that can be addressed through several complementary approaches:

  • X-ray Crystallography Strategies:

    • Lipidic cubic phase (LCP) crystallization, which has been successful for many membrane transporters

    • Antibody-mediated crystallization using conformational-specific antibodies

    • Fusion with crystallization chaperones (e.g., BRIL, T4 lysozyme)

    • Surface entropy reduction through targeted mutations

  • Cryo-Electron Microscopy:

    • Single particle analysis, particularly suitable for membrane proteins

    • Benefits from recent advances in direct electron detectors

    • No need for crystallization, reducing one major bottleneck

    • Structure determination in different conformational states

  • Integrated Structural Biology Approaches:

    • Combining lower resolution techniques (SAXS, SANS)

    • NMR for studying dynamics and substrate binding

    • Crosslinking mass spectrometry for distance constraints

    • Computational modeling informed by experimental constraints

  • Novel Approaches:

    • Micro-electron diffraction (MicroED) from nanocrystals

    • Serial crystallography at X-ray free electron lasers (XFELs)

    • In situ structural studies in native-like environments

The most promising path forward likely involves protein engineering to improve stability and expression, coupled with cryo-EM as the primary structure determination method, supplemented by molecular dynamics simulations to understand conformational changes during the transport cycle .

How might the study of GDT1-like protein 2 contribute to understanding chloroplast ion homeostasis in rice?

Investigating GDT1-like protein 2 has significant potential to advance our understanding of chloroplast ion homeostasis in rice through several research avenues:

  • Integrative Understanding of Chloroplast Transport Networks:

    • Mapping the complete suite of chloroplast ion transporters

    • Defining functional redundancy and specialization among transporters

    • Establishing the hierarchy of transport mechanisms

    • Creating predictive models of chloroplast ion fluxes

  • Stress Response Mechanisms:

    • Elucidating the role of ion transporters during abiotic stress

    • Understanding compensatory mechanisms during ion limitation

    • Identifying rate-limiting steps in photosynthetic adaptation

    • Characterizing regulatory networks controlling transporter expression

  • Evolutionary Insights:

    • Comparing GDT1 family functions across photosynthetic organisms

    • Tracking specialization of transporter functions during plant evolution

    • Identifying rice-specific adaptations in ion homeostasis

  • Biotechnological Applications:

    • Engineering improved photosynthetic efficiency through optimized ion transport

    • Developing rice varieties with enhanced stress tolerance

    • Creating biosensors for chloroplast ion levels

    • Establishing new targets for rice improvement programs

The findings from GDT1-like protein 2 research could bridge current knowledge gaps in our understanding of how rice chloroplasts maintain optimal ion concentrations for photosynthesis, particularly under varying environmental conditions. This research area has direct implications for rice productivity and adaptation to climate change .

What potential applications exist for engineered variants of GDT1-like protein 2 in rice improvement?

Engineered variants of GDT1-like protein 2 offer several promising applications for rice improvement:

  • Enhanced Photosynthetic Efficiency:

    • Optimizing Mn²⁺/Ca²⁺ transport kinetics through protein engineering

    • Fine-tuning expression levels to match environmental conditions

    • Developing variants with reduced feedback inhibition

    • Engineering pH-responsive variants for dynamic chloroplast regulation

  • Stress Tolerance Improvement:

    • Creating variants with higher ion transport capacity during stress

    • Developing cold-tolerant variants that maintain function at low temperatures

    • Engineering salt-tolerant variants that can maintain ion selectivity

    • Designing drought-responsive expression systems

  • Biofortification Applications:

    • Modifying transport specificity to enhance micronutrient accumulation

    • Engineering variants that contribute to increased grain mineral content

    • Developing tissue-specific expression strategies for targeted nutrient enrichment

  • Biosensor Development:

    • Creating fusion proteins that report on chloroplast ion status

    • Developing diagnostic tools for plant physiological status

    • Engineering variants sensitive to specific environmental contaminants

  • Production Platform Enhancement:

    • Optimizing chloroplast function for recombinant protein production

    • Improving rice as a biofactory for pharmaceutical proteins

    • Enhancing biomass production for bioenergy applications

These applications represent the intersection of fundamental understanding of GDT1-like protein 2 function with practical agricultural challenges. Successful implementation would require precise genome editing techniques, comprehensive phenotypic evaluation, and careful assessment of potential unintended consequences in the rice metabolic network .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.