Recombinant Oryza sativa subsp. japonica GDT1-like protein 5 (Os08g0433100, LOC_Os08g33630)

Shipped with Ice Packs
In Stock

Description

Genomic Context and Expression

The gene Os08g0433100 is located on chromosome 8 of the rice genome, and its expression produces a membrane-associated protein that is particularly important in Golgi apparatus function. The protein is also known by the synonym "P0431A03.16" in some databases, reflecting its original identification in genomic sequence annotation projects . Transcriptomic studies have demonstrated that this gene's expression may be subject to regulation under various environmental and developmental conditions, though specific regulatory mechanisms remain to be fully characterized.

Membrane Topology and Critical Domains

As a member of the GDT1/TMEM165 family, this protein is characterized by a distinctive membrane topology that facilitates its function as an antiporter. The protein likely contains multiple transmembrane domains that create channels for calcium and hydrogen ion exchange across cellular membranes . The amino acid sequence contains regions rich in hydrophobic residues, consistent with transmembrane segments that anchor the protein within the Golgi membrane bilayer.

Functional analysis of related GDT1 family proteins suggests that specific conserved amino acid motifs within the sequence are critical for cation binding and transport functions. These typically include acidic amino acid residues that coordinate with cations during the transport process .

Expression Systems and Purification

Recombinant GDT1-like protein 5 has been successfully expressed in Escherichia coli expression systems with an N-terminal histidine tag to facilitate purification . The recombinant protein includes the full-length sequence (amino acids 1-232) and is typically produced as a lyophilized powder following purification procedures. The expression construct ensures the production of the complete protein structure necessary for functional studies.

The purification process typically employs affinity chromatography targeting the His-tag, resulting in protein preparations with greater than 90% purity as determined by SDS-PAGE analysis . This high-purity preparation is essential for subsequent biochemical and functional characterization studies.

Calcium and Manganese Homeostasis

Based on studies of related GDT1 family proteins, GDT1-like protein 5 likely plays a crucial role in maintaining calcium and manganese homeostasis within plant cells. In yeast models, GDT1 proteins have been demonstrated to influence cellular resistance to high manganese concentrations and control cellular manganese pools . Similarly, they modulate calcium accumulation and calcium responses to environmental stresses.

The protein functions as a Ca²⁺/H⁺ antiporter, facilitating the exchange of these ions across the Golgi membrane. This activity is essential for maintaining appropriate ion concentrations within different cellular compartments, particularly within the Golgi apparatus where specific calcium levels are required for proper protein processing and trafficking .

Membrane Trafficking and Golgi Function

KEGG database classification identifies GDT1-like protein 5 as a component of the endosome-Golgi transport system . This suggests its involvement in the complex network of vesicular trafficking that moves proteins and lipids between these cellular compartments. The protein's localization at the Golgi membrane positions it to influence both the intraluminal cation content of the Golgi and potentially the composition of secretory vesicles that bud from this organelle.

Studies on yeast GDT1 proteins have revealed genetic interactions with PMR1, a well-characterized Ca²⁺-Mn²⁺ P-type ATPase that colocalizes with GDT1 at the cis- and medial-Golgi . These interactions suggest coordinated functions in maintaining appropriate ion levels within the Golgi, which are critical for multiple cellular processes including protein glycosylation, sorting, and secretion.

Functional Complementation Studies

Studies with related GDT1 family proteins have demonstrated functional complementation between orthologs from different species. For example, expression of human TMEM165 (a mammalian GDT1 ortholog) in yeast strains lacking GDT1 can restore manganese sensitivity and cellular manganese stores, indicating conserved functional mechanisms . While specific complementation studies with GDT1-like protein 5 from rice have not been extensively reported, the high degree of sequence conservation suggests similar functional conservation.

Role in Plant-Specific Processes

Recent research has begun to investigate the role of GDT1 family proteins in plant-specific processes. For instance, a 2025 study examining Bacillus velezensis 9912's effects on rice growth identified potential interactions involving LOC_Os08g33630 (GDT1-like protein 5) in the context of plant growth enhancement . This suggests that beyond basic cellular ion homeostasis, these proteins may contribute to plant-specific responses to environmental factors and microbial interactions.

Product Specs

Form
Lyophilized powder
Please note: We prioritize shipping the format currently in stock. However, if you require a specific format, kindly indicate your preference in the order remarks, and we will accommodate your request.
Lead Time
Delivery time may vary depending on the purchasing method and location. For specific delivery times, please consult your local distributors.
Note: All protein shipments are sent with standard blue ice packs. If dry ice packaging is required, please inform us in advance, as additional fees will apply.
Notes
Avoid repeated freeze-thaw cycles. For optimal usage, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly prior to opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. To facilitate long-term storage, we suggest adding 5-50% glycerol (final concentration) and aliquotation at -20°C/-80°C. Our default final concentration of glycerol is 50% and can be used as a reference.
Shelf Life
Shelf life depends on various factors such as storage conditions, buffer composition, temperature, and protein stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. For lyophilized form, the shelf life is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Repeated freeze-thaw cycles should be avoided.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag type, please inform us, and we will prioritize development accordingly.
Synonyms
Os08g0433100; LOC_Os08g33630; OsJ_27425; P0431A03.16; GDT1-like protein 5
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-232
Protein Length
full length protein
Species
Oryza sativa subsp. japonica (Rice)
Target Names
Os08g0433100
Target Protein Sequence
MAPSLLGGFTKSLAMTVLSEIGDKTFFAAAILAMRYPRKLVLAGCLTSLTVMTALSVSLG WVAPNLISRKWTHHVTTLLFFVFGILSLWEGFKEDGDSEELAEVEAELDANFKSNKAESK SKSKANDDKKKQQRPFVLQFFSPIFIKAFSITFFGEWGDKSQIATIGLAADENPFGVVLG GVLAQALCTTAAVMGGKSLASQISEKMVGLSSGVLFLLFGIMSYLSGPEGEL
Uniprot No.

Target Background

Database Links
Protein Families
GDT1 family
Subcellular Location
Membrane; Multi-pass membrane protein.

Q&A

What is the function of GDT1-like protein 5 in rice?

GDT1-like protein 5 in rice belongs to the highly conserved GDT1 protein family found across diverse organisms. Based on homology studies with yeast GDT1, this protein likely functions as a membrane transporter involved in ion homeostasis, particularly in Ca²⁺ and Mn²⁺ exchange coupled with H⁺ transport . In plants, GDT1 family members play critical roles in photosynthesis and related cellular processes . Understanding its function requires comprehensive expression analysis across tissue types and developmental stages, coupled with knockout studies to assess phenotypic consequences.

How does GDT1-like protein 5 differ structurally from GDT1-like protein 1?

While both proteins belong to the same family, GDT1-like protein 5 (Os08g0433100) and GDT1-like protein 1 (Os01g0221700) differ in several aspects. GDT1-like protein 1 is known to be chloroplastic , suggesting subcellular localization differences between these paralogs. The amino acid sequence of GDT1-like protein 1 includes multiple transmembrane domains characteristic of transport proteins, with specific motifs likely conserved across the GDT1 family . Comparative structural analysis would reveal conserved functional domains versus divergent regions that might confer specialized functions.

What expression patterns does GDT1-like protein 5 exhibit across rice tissues?

Expression pattern analysis, while not explicitly detailed for GDT1-like protein 5 in the search results, would require methodologies similar to those used for other rice genes like OsGS1;1, which showed differential expression across tissues . RT-qPCR, in situ hybridization, and promoter-reporter fusion studies would be essential to map tissue-specific and developmental expression patterns. RNA-seq data analysis across different tissues and stress conditions could further elucidate expression regulation patterns. This characterization is fundamental to understanding the protein's physiological roles in different plant organs.

What expression systems are optimal for recombinant GDT1-like protein 5 production?

For laboratory-scale production, E. coli expression systems have been successfully used for GDT1-like protein 1 and would likely be suitable for GDT1-like protein 5 with appropriate optimization. The methodological approach involves:

  • Cloning the coding sequence into an expression vector with an N-terminal His-tag

  • Transforming into an appropriate E. coli strain (e.g., BL21(DE3))

  • Optimizing expression conditions (temperature, inducer concentration, duration)

  • For membrane proteins, specialized strains and lower induction temperatures (16-20°C) are often beneficial

Alternative expression systems including yeast (P. pastoris) or insect cells may provide better folding environments for functional studies of membrane proteins like GDT1 family members.

What purification strategy yields highest functional protein recovery?

Optimal purification of GDT1-like protein 5 would involve a multi-step process:

  • Initial capture using Ni-NTA affinity chromatography targeting the N-terminal His-tag

  • Intermediate purification using ion exchange chromatography

  • Polishing step with size exclusion chromatography

For membrane proteins, inclusion of appropriate detergents throughout purification is critical. Based on protocols for similar proteins, a buffer system containing 6% trehalose at pH 8.0 helps maintain stability . Quality assessment should include SDS-PAGE, western blotting, and functional assays to verify transport activity.

What are the critical factors for maintaining protein stability post-purification?

Maintaining stability of purified GDT1-like protein 5 requires:

  • Storage in appropriate buffer conditions (Tris/PBS-based buffer with 6% trehalose at pH 8.0)

  • Addition of glycerol (final concentration 30-50%) for long-term storage

  • Storage at -20°C/-80°C with aliquoting to avoid freeze-thaw cycles

  • Reconstitution procedures that include brief centrifugation prior to opening and rehydration to 0.1-1.0 mg/mL concentration

Stability assessment through activity assays at different time points would help establish optimal storage conditions specific to GDT1-like protein 5.

How can the ion transport function of GDT1-like protein 5 be experimentally verified?

Verification of ion transport function requires multiple complementary approaches:

  • Heterologous expression systems: Expression in Lactococcus lactis bacterial cells allows direct transport measurements by monitoring intracellular or extracellular pH changes during application of Ca²⁺, Mn²⁺, or H⁺ gradients

  • Reconstitution studies: Purified protein reconstituted into proteoliposomes with fluorescent indicators for real-time monitoring of ion fluxes

  • Patch-clamp electrophysiology: For detailed kinetic characterization of transport activity

  • Complementation assays: Expression in yeast gdt1Δ mutants to assess rescue of phenotypes related to Ca²⁺/Mn²⁺ homeostasis

The experimental design should include appropriate controls and concentration-dependent measurements to determine transport kinetics.

What approaches can distinguish between Ca²⁺ and Mn²⁺ transport specificity?

Distinguishing between Ca²⁺ and Mn²⁺ transport requires:

  • Competition assays: Measuring transport of one ion in the presence of increasing concentrations of the other

  • Site-directed mutagenesis: Identifying and mutating residues potentially involved in ion selectivity

  • Direct binding studies: Using isothermal titration calorimetry or microscale thermophoresis to measure binding affinities for different ions

  • In vivo metal sensitivity assays: Comparing growth phenotypes under various Ca²⁺ and Mn²⁺ concentrations in wildtype versus mutant systems

Analysis of pH dependencies during transport would provide insights into the H⁺-coupled exchange mechanism, as demonstrated for yeast Gdt1 .

What genetic approaches can elucidate the physiological role of GDT1-like protein 5?

Several genetic strategies can reveal physiological functions:

  • CRISPR-Cas9 knockout: Creating targeted mutations in Os08g0433100 to assess loss-of-function phenotypes

  • Retrotransposon insertion lines: Screening for Tos17 insertions in GDT1-like protein 5, similar to approaches used for OsGS1;1

  • RNAi knockdown: For partial reduction of expression to identify dose-dependent effects

  • Complementation studies: Re-introducing the wildtype gene to confirm phenotype restoration, verifying causality

  • Overexpression analysis: Identifying gain-of-function phenotypes that might reveal additional roles

Phenotypic analysis should include growth parameters, ion content measurements, and responses to various environmental stresses, particularly those affecting ion homeostasis.

How can the subcellular localization of GDT1-like protein 5 be definitively determined?

Definitive subcellular localization requires multiple complementary techniques:

  • Fluorescent protein fusions: C- or N-terminal GFP fusions expressed in rice protoplasts or stable transgenic plants

  • Immunogold electron microscopy: Using specific antibodies to visualize the native protein at ultrastructural resolution

  • Subcellular fractionation: Biochemical separation of organelles followed by western blotting

  • Protease protection assays: To determine membrane topology and orientation

Comparison with localization patterns of GDT1-like protein 1, which is chloroplastic , would provide insights into potential functional divergence among family members.

What approaches can identify protein interaction partners of GDT1-like protein 5?

Interaction partner identification requires multiple strategies:

  • Co-immunoprecipitation: Using tagged GDT1-like protein 5 to pull down interacting proteins

  • Yeast two-hybrid screening: For identifying direct protein-protein interactions

  • Proximity labeling approaches: BioID or APEX2 fusion proteins to identify proximal proteins in the native environment

  • Split-ubiquitin system: Specifically designed for membrane protein interactions

  • Genetic interaction screens: Identifying synthetic lethal or suppressor interactions

Network analysis of identified partners would help place GDT1-like protein 5 in relevant biological pathways and potentially reveal regulatory mechanisms.

How does GDT1-like protein 5 contribute to photosynthetic efficiency in rice?

Investigating the role in photosynthesis requires:

  • Chlorophyll fluorescence measurements: Comparing parameters like Fv/Fm, ΦPSII, and NPQ between wildtype and mutant plants

  • Gas exchange analysis: Measuring CO₂ assimilation rates and stomatal conductance

  • Thylakoid membrane isolation: Assessing photosystem composition and electron transport rates

  • Chloroplast calcium imaging: Using genetically encoded calcium indicators to monitor Ca²⁺ dynamics

The analysis should include normal and stress conditions, as GDT1 family members in plants are implicated in photosynthetic processes , potentially through their ion transport functions affecting thylakoid lumen pH or stromal ion concentrations.

What role does GDT1-like protein 5 play in rice tolerance to abiotic stresses?

Assessing stress response roles requires multi-level analysis:

  • Stress exposure experiments: Comparing wildtype and mutant responses to drought, salinity, extreme temperatures, and metal toxicity

  • Transcriptome analysis: Identifying differentially regulated pathways in response to stress

  • Metabolite profiling: Measuring changes in osmoprotectants, antioxidants, and signaling molecules

  • Physiological measurements: Including ROS levels, membrane integrity, and photosynthetic parameters

Given the role of GDT1 family members in ion transport , particular attention should be paid to calcium signaling pathways and metal homeostasis during stress responses.

How can structural studies enhance understanding of GDT1-like protein 5 transport mechanism?

Structural biology approaches include:

  • Cryo-electron microscopy: For determining high-resolution structure of the native protein

  • X-ray crystallography: Potentially with stabilizing antibody fragments to facilitate crystallization

  • Molecular dynamics simulations: To model ion binding sites and transport pathways

  • Hydrogen-deuterium exchange mass spectrometry: For identifying conformational changes during transport cycle

These studies would provide insights into the molecular mechanism of H⁺-coupled Ca²⁺/Mn²⁺ exchange, complementing functional studies in systems like Lactococcus lactis .

What systems biology approaches can integrate GDT1-like protein 5 into broader cellular networks?

Systems-level integration requires:

  • Multi-omics data integration: Combining transcriptomics, proteomics, and metabolomics data from wildtype and mutant plants

  • Network modeling: Constructing ion homeostasis networks incorporating GDT1-like protein 5

  • Flux balance analysis: Modeling metabolic impacts of altered ion transport

  • Comparative genomics: Analyzing evolutionary conservation and divergence across species

This integration would help position GDT1-like protein 5 within the broader context of cellular physiology and identify potential applications in crop improvement.

How might genome editing technologies be applied to study GDT1-like protein 5 variants?

Advanced genome editing approaches include:

  • Base editing: Creating specific amino acid substitutions without double-strand breaks

  • Prime editing: For precise introduction of desired mutations

  • Multiplex editing: Targeting multiple GDT1 family members simultaneously to address functional redundancy

  • Promoter editing: Modifying expression patterns without altering protein sequence

These technologies allow creation of precise mutations to test structure-function hypotheses and potentially develop rice varieties with enhanced stress tolerance through optimized GDT1-like protein 5 function.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.