Recombinant Oryza sativa subsp. japonica Magnesium transporter MRS2-B (MRS2-B)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Oryza sativa subsp. japonica Magnesium Transporter MRS2-B (MRS2-B)

Recombinant Oryza sativa subsp. japonica Magnesium transporter MRS2-B (MRS2-B) is a bioengineered protein derived from the rice MRS2/MGT gene family, which belongs to the CorA-MRS2-ALR superfamily of magnesium (Mg²⁺) transporters. This recombinant protein is expressed in E. coli as a full-length construct (1–436 amino acids) with an N-terminal His tag, enabling purification and functional studies . MRS2-B plays a critical role in Mg²⁺ homeostasis, a process essential for plant growth, photosynthesis, and stress responses .

2.2. Amino Acid Sequence

The full-length sequence includes conserved motifs critical for Mg²⁺ transport, such as the GMN tripeptide (Gly-Met-Asn) in the transmembrane domain, which is essential for ion selectivity and transport activity . A partial sequence excerpt:
MSAAAASSAAGDSAKQPLLHHQRGNPPHVASVSSPSLPSAPPGALAGGRRFPGGLDVPNL KKRGGGTRSWIRVEAATASVQTLEVDKATMMRRCELPARDLRLLDPLFVYPSTILGRERA IVVNLEQIRCVITADEVLLLNSLDSYVLQYAAELQRRLLQRAEGDELPFEFRALELALEA ACSFLDAQAAELEIEAYPLLDELTSKISTLNLERVRRLKSRLVALTRRVQKVRDEIEQLM DDDGDMAEMYLSEKKLRTEASFYGDQSMLGYNSVGDGTSFSAPVSPVSSPTESRKLEKAF SLCRSRHDSVKSSDNTATEHIQELEMLLEAYFVVIDSTLNKLTSLKEYIDDTEDFINIQL DNVRNQLIQFELLLTTATFVVAIFGVVAGIFGMNFETSVFSIQNAFQWVLIITGVIGAFI FCGFLWFFKYKRLMPL .

Production and Purification

MRS2-B is synthesized in E. coli and purified using affinity chromatography due to the His tag. The protein is lyophilized in a Tris/PBS buffer with 6% trehalose to enhance stability . Post-delivery handling includes:

  • Reconstitution: Dissolve in deionized water (0.1–1.0 mg/mL) with optional glycerol (5–50% final concentration) for storage at -20°C/-80°C .

  • Avoidance of Freeze-Thaw Cycles: Repeated freezing/thawing compromises activity .

4.1. Mg²⁺ Transport Mechanism

MRS2 proteins form oligomeric channels (e.g., pentamers in human MRS2) with conserved Mg²⁺-binding sites. These sites regulate ion flux and gating . In Arabidopsis, MRS2/MGT family members localize to root membranes, suggesting roles in soil Mg²⁺ uptake .

4.2. Tissue-Specific Expression

Rice MRS2 family members exhibit varied tissue expression:

ProteinLocalizationExpression Pattern
OsMRS2-5ChloroplastLow in unexpanded leaves; increases with maturation
OsMRS2-6ChloroplastDiurnal oscillations in mature leaves

MRS2-B may share similar compartmentalization, potentially in chloroplasts or root membranes.

Comparative Analysis with Other Rice MRS2 Isoforms

AttributeMRS2-B (Q67UQ7)MRS2-I (Q10D38)
Gene LocusOs06g0650800Os03g0742400
Expression RegionFull-length (1–436 aa)Full-length (1–384 aa)
TagHisUndetermined
HostE. coliE. coli (cell-free expr.)

MRS2-B differs from MRS2-I in gene structure and expression regions, suggesting distinct functional roles .

Applications and Research Potential

MRS2-B serves as a tool for:

  • Plant Physiology: Studying Mg²⁺ uptake under stress (e.g., aluminum toxicity) .

  • Biotechnology: Engineering crops with enhanced Mg²⁺ efficiency for improved yield.

  • Structural Biology: Investigating conserved motifs (e.g., GMN tripeptide) in Mg²⁺ transport .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a guideline.
Shelf Life
Shelf life depends on several factors: storage conditions, buffer components, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during the production process. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
MRS2-B; Os06g0650800; LOC_Os06g44150; P0453H04.31; Magnesium transporter MRS2-B
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-436
Protein Length
full length protein
Species
Oryza sativa subsp. japonica (Rice)
Target Names
MRS2-B
Target Protein Sequence
MSAAAASSAAGDSAKQPLLHHQRGNPPHVASVSSPSLPSAPPGALAGGRRFPGGLDVPNL KKRGGGTRSWIRVEAATASVQTLEVDKATMMRRCELPARDLRLLDPLFVYPSTILGRERA IVVNLEQIRCVITADEVLLLNSLDSYVLQYAAELQRRLLQRAEGDELPFEFRALELALEA ACSFLDAQAAELEIEAYPLLDELTSKISTLNLERVRRLKSRLVALTRRVQKVRDEIEQLM DDDGDMAEMYLSEKKLRTEASFYGDQSMLGYNSVGDGTSFSAPVSPVSSPTESRKLEKAF SLCRSRHDSVKSSDNTATEHIQELEMLLEAYFVVIDSTLNKLTSLKEYIDDTEDFINIQL DNVRNQLIQFELLLTTATFVVAIFGVVAGIFGMNFETSVFSIQNAFQWVLIITGVIGAFI FCGFLWFFKYKRLMPL
Uniprot No.

Target Background

Function
A magnesium transporter potentially mediating magnesium influx.
Database Links

KEGG: osa:4341687

UniGene: Os.11134

Protein Families
CorA metal ion transporter (MIT) (TC 1.A.35.5) family
Subcellular Location
Membrane; Multi-pass membrane protein.

Q&A

What is the MRS2-B transporter and what is its role in rice?

MRS2-B (Uniprot ID: Q67UQ7) is a magnesium transporter protein belonging to the MRS2/MGT gene family in Oryza sativa subsp. japonica. It is part of the broader CorA-MRS2-ALR-type superfamily of membrane proteins, which are characterized by a distinctive GMN tripeptide motif (Gly-Met-Asn) located at the end of the first of two C-terminal transmembrane domains .

MRS2-B functions primarily in magnesium transport across biological membranes, playing a crucial role in magnesium homeostasis in rice. Like other members of the MRS2/MGT family, it may be involved in the uptake, translocation, and distribution of Mg²⁺ ions throughout the plant, which is essential for multiple physiological processes including chlorophyll production, enzyme activation, and photosynthesis .

What methods can be used to directly measure MRS2-B-mediated magnesium transport?

The mag-fura-2 fluorescence system has been established as an effective method for directly measuring Mg²⁺ uptake mediated by MRS2 transporters. This technique allows real-time monitoring of magnesium transport across biological membranes .

Methodology:

  • Isolate mitochondria or membrane vesicles expressing the recombinant MRS2-B protein

  • Load the isolated organelles with the fluorescent dye mag-fura-2

  • Measure fluorescence using spectrofluorometric techniques

  • Apply increasing external Mg²⁺ concentrations and record the changes in fluorescence

  • Calculate uptake rates based on the fluorescence ratio at 340/380 nm excitation wavelengths

The mag-fura-2 is a UV-excitable, Mg²⁺-dependent fluorescent indicator that undergoes a blue shift from 380 to 340 nm upon Mg²⁺ binding, allowing for quantitative assessment of magnesium transport activity . This method has been successfully applied to characterize multiple members of the MRS2/MGT family and provides a more direct confirmation of Mg²⁺ transport compared to indirect growth complementation assays.

How can heterologous expression systems be used to study MRS2-B function?

Heterologous expression in yeast (Saccharomyces cerevisiae) mutants defective in magnesium transport provides a powerful system for functional characterization of MRS2-B. The methodology involves:

  • Clone the full-length MRS2-B cDNA into an appropriate yeast expression vector

  • Transform the construct into yeast mrs2 mutant strains defective in mitochondrial magnesium transport

  • Assess complementation by monitoring:

    • Growth restoration under magnesium-limiting conditions

    • Direct Mg²⁺ uptake using the mag-fura-2 system

    • Mitochondrial magnesium content

Research has shown that members of the MRS2/MGT family can complement the yeast mrs2 mutant to varying degrees, confirming their function as magnesium transporters . The complementation assay provides initial evidence of transport activity, while the mag-fura-2 system allows for quantitative assessment of transport kinetics.

What is the tissue-specific expression pattern of MRS2-B in rice plants?

Understanding the tissue-specific expression of MRS2-B requires methodical analysis across different plant tissues and developmental stages. Based on research on MRS2 family members:

  • Root expression: Several MRS2 family members, including some in rice, show expression in root tissues, indicating potential roles in the initial uptake of magnesium from soil solution .

  • Developmental stage specificity: Expression patterns vary according to developmental stages, with different expression profiles during vegetative and reproductive phases .

To determine the precise expression pattern of MRS2-B, researchers should:

  • Employ promoter-GUS fusion assays to visualize tissue-specific expression

  • Conduct RT-qPCR analysis of different tissues at multiple developmental stages

  • Use RNA-seq data to compare expression levels across tissues

For a comprehensive analysis, samples should include roots, basal stem, leaf sheath, leaf blade at vegetative stage, and additional reproductive tissues such as nodes, internodes, peduncle, rachis, spikelet, husk, and seed .

How does magnesium deficiency affect MRS2-B expression?

To investigate how MRS2-B responds to magnesium deficiency, a controlled experimental approach is essential:

  • Grow seedlings in hydroponics with standard nutrient solution for 2 weeks

  • Transfer to treatment solutions:

    • Control: Complete nutrient solution with 1.0 mM MgSO₄·7H₂O

    • Deficiency: Nutrient solution without Mg²⁺ addition

  • Maintain plants for 3 weeks under controlled conditions: 14h light (30°C)/10h dark (22°C), 60% relative humidity

  • Collect tissue samples (roots and shoots separately)

  • Extract RNA and perform RT-qPCR using gene-specific primers

Research on MRS2 family genes has shown differential expression responses to magnesium deficiency, indicating their involvement in magnesium homeostasis mechanisms . For MRS2-B specifically, expression analysis under various Mg²⁺ concentrations would elucidate its potential role in deficiency response.

What phenotypes are associated with MRS2-B knockout or overexpression in rice?

The functional significance of MRS2-B can be understood through genetic manipulation approaches. Based on studies of related MRS2 family members:

For knockout characterization:

  • Generate knockouts using CRISPR-Cas9 or T-DNA insertion methods

  • Cultivate plants under varying magnesium concentrations

  • Evaluate phenotypes for:

    • Growth parameters (biomass, height, root development)

    • Magnesium content in different tissues

    • Physiological responses (photosynthetic efficiency, chlorophyll content)

Studies in Arabidopsis have shown that single knockouts of MRS2 genes often display subtle phenotypes, while double or triple knockouts can exhibit severe developmental retardation under limiting Mg²⁺ conditions . Similar patterns might be expected for rice MRS2-B, particularly if functional redundancy exists with other family members.

For overexpression studies:

  • Generate transgenic lines expressing MRS2-B under a strong constitutive promoter

  • Assess magnesium content and distribution

  • Evaluate growth under normal and limiting Mg²⁺ conditions

Overexpression of magnesium transporters like OsMGT1 has been shown to increase Mg²⁺ concentration in rice seedlings, particularly under low-Mg²⁺ supply conditions .

How do different divalent cations interact with MRS2-B transport activity?

Understanding the selectivity and interaction of MRS2-B with various divalent cations requires systematic transport assays:

  • Set up mag-fura-2 loaded membrane systems expressing MRS2-B

  • Measure Mg²⁺ uptake in the presence of competing divalent cations (Ca²⁺, Zn²⁺, Mn²⁺, Co²⁺, Cd²⁺, Cu²⁺)

  • Determine inhibition patterns and calculate IC₅₀ values

Research on MRS2 transporters suggests complex interactions between magnesium and calcium homeostasis. Growth retardation phenotypes in Arabidopsis MRS2 mutants under low Mg²⁺ conditions can be ameliorated when Ca²⁺ concentrations are concomitantly lowered . This finding supports the hypothesis of an important interplay between these two most abundant divalent cations in plant nutrient homeostasis.

How does rice MRS2-B compare with other MRS2 family members in different plant species?

Phylogenetic analysis of MRS2 proteins reveals distinct evolutionary relationships:

The MRS2 family in plants can be classified into five major clades (A-E) based on sequence similarity and evolutionary relationships. Rice MRS2 proteins (including MRS2-B) show specific relationships with their Arabidopsis homologs within these clades .

To conduct a thorough comparative analysis:

  • Perform multiple sequence alignment of MRS2 proteins from diverse plant species

  • Construct phylogenetic trees to determine evolutionary relationships

  • Identify conserved domains and motifs, particularly the GMN tripeptide and transmembrane regions

  • Compare tissue expression patterns and functional data across species

Table 1: Key Features of MRS2 Family Members Across Plant Species

CladeRice MembersArabidopsis MembersTissue ExpressionFunctional Characteristics
ATBDAtMRS2-2, AtMRS2-3Various tissuesDiverse Mg²⁺ transport functions
BMRS2-BAtMRS2-1, AtMRS2-5, AtMRS2-10Early seedlings, rootsDevelopmental roles, Mg²⁺ homeostasis
CTBDAtMRS2-4, AtMRS2-6Leaf tissuesPhotosynthesis-related functions
DTBDAtMRS2-7, AtMRS2-8Vascular tissuesLong-distance Mg²⁺ transport
ETBDAtMRS2-11Multiple tissuesGeneral Mg²⁺ homeostasis

Note: This table is partially based on information from search results and would need to be completed with specific data for rice MRS2 members.

How can QTL mapping for magnesium transport inform rice improvement strategies?

Quantitative Trait Loci (QTL) mapping offers valuable insights for crop improvement related to magnesium utilization. Key methodological approaches include:

  • Develop appropriate mapping populations (e.g., MAGIC populations)

  • Phenotype for magnesium-related traits:

    • Root Mg²⁺ concentration

    • Shoot Mg²⁺ concentration

    • Mg²⁺ translocation efficiency

  • Conduct genotyping using high-density SNP arrays

  • Perform association analysis to identify QTLs related to magnesium traits

Research has identified several QTLs related to magnesium uptake and translocation in rice:

  • Four QTLs (qRMg1, qRMg2, qRMg7, qRMg8) for root Mg²⁺ concentration, explaining 11.45-13.08% of phenotypic variation

  • Three QTLs (qSMg3, qSMg7, qSMg10) for shoot Mg²⁺ concentration, explaining 4.30-5.46% of phenotypic variation

  • Two QTLs (qTrMg3, qTrMg8) affecting Mg²⁺ translocation from roots to shoots, explaining 10.91% and 9.63% of phenotypic variation

Notably, the magnesium transporter gene OsMGT1 was found within the region of qRMg1, supporting its role in magnesium uptake. MRS2-B and other magnesium transporters should be analyzed for their potential co-localization with identified QTLs .

Can MRS2-B be targeted to improve magnesium use efficiency in rice crops?

Engineering improved magnesium use efficiency through MRS2-B manipulation requires systematic approaches:

  • Genetic modification strategies:

    • Overexpression using constitutive or tissue-specific promoters

    • Precision editing of regulatory regions to enhance expression under deficiency

    • Protein engineering to improve transport kinetics

  • Evaluation parameters:

    • Mg²⁺ uptake efficiency from soil/solution

    • Translocation and partitioning of Mg²⁺ between tissues

    • Growth and yield under varying Mg²⁺ availability

    • Interaction with other nutrients, particularly calcium

Studies have shown that overexpression of magnesium transporters can significantly increase Mg²⁺ concentration in rice seedlings, especially under conditions of low Mg²⁺ supply . This suggests that MRS2-B could potentially be targeted to enhance magnesium acquisition and utilization in rice crops grown on magnesium-deficient soils.

How do multiple MRS2 transporters coordinate magnesium homeostasis in rice?

Understanding the complex network of magnesium transporters presents significant research challenges that require sophisticated methodological approaches:

  • Generate combinations of multiple knockout/knockdown lines:

    • Double and triple knockouts of MRS2 family genes

    • CRISPR-Cas9 multiplex targeting of several MRS2 genes simultaneously

    • Combination of knockouts across different clades of the MRS2 family

  • Conduct comprehensive phenotyping:

    • Growth under various Mg²⁺ concentrations

    • Tissue-specific Mg²⁺ distribution

    • Physiological parameters under stress conditions

  • Analyze transcriptional responses:

    • RNA-seq of single and multiple mutants

    • Identification of compensatory expression changes

    • Potential transcriptional regulatory networks

Research in Arabidopsis has shown that while single knockouts of MRS2 genes (AtMRS2-1, AtMRS2-5) may not show significant phenotypes, double (AtMRS2-1/10) and triple (AtMRS2-1/5/10) knockouts exhibit severe developmental retardation under limiting Mg²⁺ concentrations . This indicates functional redundancy and cooperation among MRS2 family members, a pattern likely to exist in rice as well.

What is the molecular mechanism of magnesium-calcium interaction in plant nutrient homeostasis?

The observed interaction between magnesium and calcium represents an intriguing area for advanced research:

  • Experimental approaches to investigate Mg²⁺-Ca²⁺ interactions:

    • Hydroponic cultivation under factorial combinations of Mg²⁺ and Ca²⁺ concentrations

    • Small-scale liquid culturing systems in multi-well plates for high-throughput phenotyping

    • Monitoring of developmental stages and biomass accumulation

  • Molecular mechanisms to investigate:

    • Competition at the transporter level

    • Signaling pathways responding to Mg²⁺/Ca²⁺ ratio changes

    • Transcriptional responses to varying Mg²⁺/Ca²⁺ ratios

Research has demonstrated that growth retardation phenotypes in Arabidopsis MRS2 mutants under low Mg²⁺ conditions can be ameliorated when Ca²⁺ concentrations are concomitantly lowered . This suggests a complex interplay between these divalent cations, potentially involving competitive transport, altered cell wall properties, or shared signaling components.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.