Recombinant Oryza sativa subsp. japonica Magnesium transporter MRS2-F (MRS2-F)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which may serve as a guideline for your use.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
If you require a specific tag, please inform us, and we will prioritize its implementation.
Synonyms
MRS2-F; Os01g0908500; LOC_Os01g68040; B1417F08.35; OsJ_04478; P0456E05.8; P0497A05.17; Magnesium transporter MRS2-F
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-444
Protein Length
full length protein
Species
Oryza sativa subsp. japonica (Rice)
Target Names
MRS2-F
Target Protein Sequence
MRPSAAAGGGGGGGGRRKAAAAAAAASREWLVVPASGQARVEEAGKHAVMARTGLPARDL RVLDPLLSYPSTILGRERAIVVNLERVKAVITAAEVLLPNSKDPAFASFVCDLQARVLAS SSDQAAEFTDMEGESSAVTSPFPALTSTTPNELEMTNKNSNVVGGMTHSNSMPTLTAAKD GNTKVLPFEFRALEVCLESACRSLEEETSTLEQEAYPALDELTSKISTLNLERVRQIKSR LVAISGRVQKVRDELEHLLDDEMDMAEMYLTEKLTRQEISETSSRVEVDDPSQLEVDRDE DYRSEADVSNGTFIGYKPHIEELEMLLEAYFVQIDGTLNKLSHLREYVDDTEDYINIMLD DKQNQLLQMGVMLSTATVVITAGVAVVGLFGMNIGISLYADPTNEEEKRASNMKFWETTL GTIAGCTVMYIVAMGWGKRSGLLQ
Uniprot No.

Target Background

Function
A magnesium transporter potentially mediating magnesium influx.
Database Links

KEGG: osa:4324988

UniGene: Os.26355

Protein Families
CorA metal ion transporter (MIT) (TC 1.A.35.5) family
Subcellular Location
Membrane; Multi-pass membrane protein.

Q&A

What is the MRS2/MGT gene family in rice and how is it classified?

The MRS2/MGT gene family in rice belongs to the superfamily of CorA-MRS2-ALR-type membrane proteins. These magnesium transporters are characterized by a distinctive GMN tripeptide motif (Gly-Met-Asn) located at the end of the first of two C-terminal transmembrane domains . Phylogenetic analysis typically organizes MRS2/MGT transporters into five distinct clusters based on sequence similarity. Rice MRS2 transporters, including MRS2-F, often show closer sequence similarity to Arabidopsis homologs compared to those from other monocots . For accurate classification, researchers should construct phylogenetic trees using multiple sequence alignment tools incorporating MRS2/MGT sequences from diverse plant species including Arabidopsis, tomato, maize, and rice.

What are the key structural features that define MRS2-F functionality?

MRS2-F functionality is primarily defined by conserved structural elements. Most critical is the GMN tripeptide motif within the transmembrane domains, which is essential for magnesium transport activity . Additional conserved domains typically include magnesium transport domains and characteristic transmembrane regions. Structural analysis should include domain identification using tools like SMART or Pfam, conserved motif identification using MEME, and transmembrane topology prediction using TMHMM or similar tools. Researchers should verify these structural features experimentally through site-directed mutagenesis of the conserved motifs, followed by functional complementation assays.

How can I confirm subcellular localization of MRS2-F in rice cells?

To confirm subcellular localization of MRS2-F in rice cells, researchers should use a combination of computational prediction and experimental verification approaches:

Computational prediction:

  • Use tools like TargetP, Predotar, or PSORT to predict subcellular targeting signals

  • Analyze for presence of mitochondrial targeting peptides, which are common in MRS2 family members

Experimental verification:

  • Construct MRS2-F-GFP fusion proteins under native or constitutive promoters

  • Perform confocal microscopy and super-resolution structured illumination microscopy (SIM) on transformed rice cells

  • Use specific organelle markers (e.g., Cox8-mRFP for mitochondria) for co-localization studies

  • Perform intensity profile analysis to confirm overlap between MRS2-F-GFP signal and organelle marker signals

  • Conduct subcellular fractionation followed by Western blot analysis as confirmation

When performing these experiments, it's critical to verify that the GFP tag doesn't interfere with protein targeting or function through complementary functional assays.

How does the expression of MRS2-F vary across different rice tissues?

MRS2 transporters typically show tissue-specific expression patterns. Based on studies of MRS2 family members in rice and other plants, expression varies significantly across tissues:

Experimental approach:

  • Collect RNA from multiple rice tissues (roots, stems, leaves, inflorescences, developing seeds)

  • Perform qRT-PCR using gene-specific primers for MRS2-F

  • Analyze expression data using appropriate reference genes (e.g., Actin, Ubiquitin)

Expected patterns:

  • Some MRS2 transporters show high expression in roots, suggesting a role in Mg²⁺ uptake from soil

  • Others may be predominantly expressed in leaves or reproductive tissues

  • MRS2 genes may be expressed cooperatively, with differing spatial patterns

For comprehensive analysis, perform both semi-quantitative PCR and quantitative real-time PCR, and validate with RNA-seq data analysis where available. Consider developmental stages as MRS2 expression often changes throughout plant development.

How is MRS2-F expression regulated under Mg²⁺ deficiency and toxicity conditions?

The expression of MRS2 transporters responds dynamically to Mg²⁺ availability. Research approaches to study this include:

Experimental design:

  • Grow rice seedlings hydroponically under three Mg²⁺ conditions:

    • Control (1.0 mM MgSO₄·7H₂O)

    • Deficiency (0-0.05 mM MgSO₄·7H₂O)

    • Toxicity (5-10 mM MgSO₄·7H₂O)

  • Harvest tissues at multiple time points (6h, 12h, 24h, 3d, 7d)

  • Extract RNA and perform qRT-PCR

Typical observations:

  • Under Mg²⁺ limitation, MRS2 transporters may be down-regulated in leaves, with greater impact on lower and middle leaves compared to young leaves

  • Under Mg²⁺ toxicity, some MRS2 genes are up-regulated with possible circadian rhythm patterns

  • Expression patterns often show tissue-specificity, with different responses in roots versus shoots

  • Time-course analysis is critical as expression changes may vary over short (hours) and long (days) time scales

Analysis should include both spatial (different tissues) and temporal (time course) components to capture the full regulatory landscape.

What are reliable systems to verify the Mg²⁺ transport activity of recombinant MRS2-F?

Multiple complementary systems can verify Mg²⁺ transport activity:

Yeast functional complementation:

  • Use the Mg²⁺ transport-defective yeast mutant CM66, which lacks plasma membrane Mg²⁺ transporters ALR1 and ALR2

  • Clone the open reading frame of MRS2-F into an expression vector (e.g., pYES2)

  • Transform yeast cells and select transformants on appropriate media

  • Test growth on media with varying Mg²⁺ concentrations (1, 4, 64 mmol/L MgCl₂)

  • Measure growth by spotting serial dilutions and by monitoring OD₆₀₀ in liquid culture

Direct Mg²⁺ uptake measurement:

  • Use the mag-fura-2 fluorescent dye system for real-time Mg²⁺ uptake measurement

  • This allows direct confirmation of Mg²⁺ transport over biological membranes

  • Compare uptake efficiency with other characterized MRS2 transporters as controls

Bacterial complementation:

  • Use bacterial strain MM281 with impaired Mg²⁺ transport

  • Assess functional complementation by MRS2-F expression

These systems provide complementary evidence, as some transporters may show differential activity in different expression systems.

How can CRISPR/Cas9 be used to evaluate the physiological role of MRS2-F in rice?

CRISPR/Cas9 gene editing offers a powerful approach to elucidate MRS2-F function:

Experimental workflow:

  • sgRNA design and construct preparation:

    • Design sgRNAs targeting conserved regions of MRS2-F, particularly the GMN motif

    • Assemble CRISPR/Cas9 constructs with rice-optimized Cas9 and appropriate promoters

    • Include selection markers for transformation screening

  • Rice transformation and mutant identification:

    • Transform rice calli using Agrobacterium-mediated transformation

    • Screen T₀ plants for mutations using targeted sequencing

    • Identify homozygous knockout lines in T₁ or T₂ generations

  • Phenotypic characterization:

    • Compare growth of wild-type and mutant plants under varying Mg²⁺ conditions

    • Measure Mg²⁺ content in different tissues using atomic absorption spectroscopy

    • Assess physiological parameters (photosynthesis, root development, stress tolerance)

  • Molecular complementation:

    • Reintroduce wild-type MRS2-F to confirm phenotype rescue

    • Introduce mutated versions (e.g., altered GMN motif) to validate functional domains

For advanced analysis, consider creating tissue-specific knockouts using tissue-specific promoters driving Cas9 expression to overcome potential lethality of complete knockouts.

How does MRS2-F contribute to aluminum toxicity tolerance in rice?

Mg²⁺ transporters can play significant roles in alleviating aluminum (Al) toxicity:

Research approach:

  • Comparative analysis:

    • Expose wild-type and MRS2-F knockout/overexpression lines to aluminum stress

    • Use hydroponic culture with AlCl₃ (50-200 μM) at acidic pH (4.2-4.5)

    • Measure root elongation, a primary indicator of Al toxicity

  • Physiological mechanisms:

    • Analyze Mg²⁺ content in roots and shoots under Al stress

    • Investigate if MRS2-F improves Al tolerance by enhancing cellular Mg²⁺ concentrations

    • Measure organic acid exudation (malate, citrate) as Al-tolerance mechanisms

  • Molecular interactions:

    • Study interactions between MRS2-F and known Al-tolerance genes

    • Examine if MRS2-F's subcellular localization changes under Al stress

    • Investigate if MRS2-F affects expression of other Al-responsive genes

Similar to Arabidopsis homologs, different MRS2 transporters may show differential sensitivity to Al toxicity based on their subcellular localization. Vacuolar-localized transporters might show less sensitivity compared to plasma membrane transporters .

What is the relationship between MRS2-F expression and rice growth under Mg²⁺ limitation?

Understanding growth responses under Mg²⁺ limitation requires detailed physiological characterization:

Experimental design:

  • Growth conditions:

    • Grow rice in hydroponic culture with varying Mg²⁺ concentrations (0, 10, 50, 250, 1000 μM)

    • Include wild-type, MRS2-F knockout, and MRS2-F overexpression lines

    • Maintain other nutrients at optimal levels while varying only Mg²⁺

  • Growth parameters to measure:

    • Shoot and root biomass

    • Plant height and root length

    • Chlorophyll content (Mg²⁺ is central to chlorophyll molecules)

    • Photosynthetic efficiency (Fv/Fm, quantum yield)

  • Molecular analysis:

    • Monitor expression levels of MRS2-F and other Mg²⁺ transporters

    • Analyze if compensatory expression of other transporters occurs in MRS2-F mutants

    • Measure Mg²⁺ content in different tissues to assess translocation efficiency

MRS2 transporters typically show magnesium-dependent phenotypes of growth retardation when Mg²⁺ concentrations are below 50 μM in hydroponic cultures . The severity of this phenotype can indicate the importance of specific transporters in Mg²⁺ uptake and translocation.

What QTLs associated with Mg²⁺ transport contain or interact with MRS2-F?

QTL analysis provides insight into the genetic architecture of Mg²⁺ transport:

Methodological approach:

  • Population development:

    • Use multi-parent advanced generation inter-cross (MAGIC) populations or biparental populations

    • Genotype using high-density SNP arrays (e.g., 55K rice SNP array)

  • Phenotyping:

    • Measure Mg²⁺ concentration in roots and shoots separately

    • Calculate translocation efficiency (shoot/root Mg²⁺ ratio)

    • Perform measurements at multiple growth stages

  • QTL analysis:

    • Conduct genome-wide association studies (GWAS) or interval mapping

    • Look for QTLs associated with:

      • Root Mg²⁺ concentration (e.g., qRMg1, qRMg2, qRMg7, qRMg8)

      • Shoot Mg²⁺ concentration (e.g., qSMg3, qSMg7, qSMg10)

      • Mg²⁺ translocation (e.g., qTrMg3, qTrMg8)

  • Candidate gene identification:

    • Map MRS2-F relative to identified QTLs

    • Analyze sequence variations in MRS2-F between high and low Mg²⁺-accumulating varieties

    • Perform haplotype analysis of MRS2-F across diverse rice germplasm

Known QTLs associated with Mg²⁺ transport may explain 4-13% of phenotypic variation depending on the trait .

How can candidate genes within Mg²⁺ transport QTLs be validated experimentally?

Validation of candidate genes requires multiple complementary approaches:

Experimental validation pipeline:

  • Expression analysis:

    • Compare expression patterns between contrasting parents using qRT-PCR

    • Test response to Mg²⁺ deficiency and toxicity conditions

    • Examine tissue-specific expression patterns

  • Sequence analysis:

    • Identify SNPs or InDels in coding regions or promoters

    • Analyze potential functional impacts of variants

    • Compare sequences across diverse germplasm

  • Functional complementation:

    • Test in heterologous systems like yeast CM66 mutant

    • Evaluate growth under different Mg²⁺ concentrations

    • Measure direct Mg²⁺ uptake using fluorescent indicators

  • Genetic modification in rice:

    • Generate overexpression lines

    • Create CRISPR/Cas9 knockout lines

    • Test whether phenotypes correlate with Mg²⁺ transport abilities

    • Verify if the gene can significantly increase Mg²⁺ concentration under low Mg²⁺ supply

Validation MethodAdvantagesLimitationsExpected Results
qRT-PCRRapid, quantitativeCorrelative onlyDifferential expression under varying Mg²⁺
Yeast ComplementationDirect functional testHeterologous systemGrowth restoration in Mg²⁺-deficient media
OverexpressionTests sufficiencyPossible artifacts from non-native expressionIncreased Mg²⁺ accumulation
CRISPR KnockoutTests necessityPotential compensationReduced Mg²⁺ uptake/translocation

How can MRS2-F be engineered to improve Mg²⁺ use efficiency in rice?

Engineering approaches for enhancing MRS2-F function include:

Genetic modification strategies:

  • Promoter engineering:

    • Replace native promoter with constitutive (e.g., CaMV 35S, Ubiquitin) or stress-inducible promoters

    • Use tissue-specific promoters for targeted expression in roots or vascular tissues

    • Design synthetic promoters with enhanced responsiveness to Mg²⁺ deficiency

  • Protein engineering:

    • Modify amino acids in the selectivity filter to enhance transport efficiency

    • Optimize codon usage for increased protein production

    • Create chimeric transporters combining domains from high-efficiency homologs

  • Regulatory network manipulation:

    • Identify and modify transcription factors regulating MRS2-F

    • Edit cis-regulatory elements to enhance expression

    • Target miRNAs that regulate MRS2-F expression

For each approach, compare engineered lines with wild-type under varying Mg²⁺ conditions (0-1000 μM) and measure:

  • Growth parameters (biomass, yield components)

  • Mg²⁺ uptake efficiency (μmol Mg²⁺/g root DW/day)

  • Mg²⁺ utilization efficiency (biomass produced per unit Mg²⁺)

  • Stress tolerance (drought, salinity, aluminum toxicity)

What are the interactions between Mg²⁺ transporters and calcium transporters in rice?

The interplay between magnesium and calcium transport systems requires sophisticated investigation:

Research approach:

  • Dual ion transport studies:

    • Measure Ca²⁺ uptake in MRS2-F overexpression and knockout lines

    • Test Mg²⁺ uptake in Ca²⁺ transporter mutants

    • Conduct competition assays with varying Mg²⁺:Ca²⁺ ratios

  • Molecular interactions:

    • Perform yeast two-hybrid or co-immunoprecipitation to detect protein-protein interactions

    • Investigate if MRS2-F forms complexes with Ca²⁺ transporters or regulators

    • Study co-expression patterns of Mg²⁺ and Ca²⁺ transporters

  • Signaling crosstalk:

    • Analyze if calcium signaling components (e.g., CaM, CDPK) regulate MRS2-F activity

    • Study if Mg²⁺ status affects expression of Ca²⁺ transporters

    • Investigate shared transcriptional regulators

Research on mammalian systems suggests potential interactions between Mg²⁺ transporters (Mrs2) and calcium signaling components, particularly in mitochondria where Mg²⁺ can act as a rheostat for calcium uptake . Similar relationships may exist in plant systems, affecting cellular ion homeostasis and signaling networks.

How can high-throughput phenotyping be used to assess MRS2-F function in large rice populations?

High-throughput approaches enable efficient functional characterization:

Phenotyping strategies:

  • Image-based phenotyping:

    • Use chlorophyll fluorescence imaging to detect early Mg²⁺ deficiency symptoms

    • Apply hyperspectral imaging to identify spectral signatures of Mg²⁺ status

    • Implement root phenotyping systems to measure root architecture changes

  • Ionomic profiling:

    • Use ICP-MS for multi-element analysis in diverse germplasm

    • Develop rapid XRF screening methods for elemental composition

    • Correlate Mg²⁺ content with MRS2-F haplotypes across populations

  • Field-based approaches:

    • Deploy drone-based multispectral imaging in field trials

    • Install IoT-based sensors for continuous monitoring of plant performance

    • Conduct trials across multiple environments with varying soil Mg²⁺ levels

  • Data analysis:

    • Apply machine learning algorithms to identify subtle phenotypic signatures

    • Develop predictive models relating MRS2-F variants to plant performance

    • Integrate multi-omics data (genomics, transcriptomics, ionomics) for comprehensive analysis

These approaches enable screening thousands of genotypes to identify optimal MRS2-F variants for breeding programs targeting improved magnesium efficiency.

What are the key unexplored research questions regarding MRS2-F function in rice?

Several frontier research questions remain for future investigation:

Emerging research directions:

These questions will drive future research using emerging technologies such as cryo-EM for structural studies, single-cell transcriptomics for cell-specific expression analysis, and genome-wide CRISPR screens for identifying genetic interactions.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.