Recombinant Oryza sativa subsp. japonica Metal tolerance protein 2 (MTP2)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to settle the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during manufacturing.
The specific tag will be determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
MTP2; Os03g0346800; LOC_Os03g22550; OsJ_10821; Metal tolerance protein 2; OsMTP2
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-389
Protein Length
full length protein
Species
Oryza sativa subsp. japonica (Rice)
Target Names
MTP2
Target Protein Sequence
MGFRLAHLAACVARAAASSSRLRGPRPAASALVAPLLASPWEPSGGGQPHWLVPSRGHVG HSHHHHHGEEVGGEASERIFRLGLAADVVLTVGKAVTGYLSGSTAIAADAAHSLSDIVLS GVALLSYKAAKAPRDKEHPYGHGKFESLGALGISSMLLVTAGGIAWHAFDVLQGVMSSAP DIIGNVSHAHHSHGSSGHHHGIDLEHPILALSVTAFAISVKEGLYWITKRAGEKEGSGLM KANAWHHRSDAISSVVALLGVGGSILGVPYLDPLAGLVVSGMILKAGVHTGYESVLELVD AAVDPSLLQPIKETILQVDGVKGCHRLRGRKAGTSLYLDVHIEVYPFLSVSAAHDIGETV RHQIQKSHNQVAEVFIHIGSLQPLNQNAL
Uniprot No.

Target Background

Function
This protein is involved in the sequestration of excess cytoplasmic metal ions into vacuoles, thereby maintaining cellular metal homeostasis.
Database Links
Protein Families
Cation diffusion facilitator (CDF) transporter (TC 2.A.4) family, SLC30A subfamily
Subcellular Location
Vacuole membrane; Multi-pass membrane protein. Note=Tonoplast.

Q&A

What is the primary function of MTP2 in Oryza sativa?

MTP2 in Oryza sativa belongs to the Metal Tolerance Protein family, which functions primarily in metal ion transport and homeostasis. Based on studies of MTPs in plants, MTP2 likely plays a crucial role in heavy metal detoxification, particularly for metals such as zinc, iron, manganese, and possibly cadmium. In rice, MTP2 is involved in metal transport across cellular membranes, contributing to metal tolerance mechanisms that protect the plant from metal toxicity .

What genomic and proteomic resources are available for studying rice MTP2?

Researchers can access rice MTP2 genomic data through the KEGG GENOME database for Oryza sativa japonica . This resource provides comprehensive genomic information, including gene structure, coding sequences, and genetic variants. For proteomic analysis, recombinant protein expression systems can be used to produce MTP2 for structural and functional studies. Transcriptomic datasets from studies on rice stress responses may also contain valuable information about MTP2 expression patterns under various conditions .

What are the optimal expression systems for producing recombinant rice MTP2 protein?

For recombinant rice MTP2 expression, several systems can be considered depending on research objectives:

  • Bacterial systems: E. coli expression is suitable for basic biochemical studies and produces non-glycosylated protein, similar to how IL-2 C126S is expressed . Use codon-optimized constructs to overcome codon bias issues common with plant proteins in bacterial hosts.

  • Yeast systems: Pichia pastoris or Saccharomyces cerevisiae provide eukaryotic expression environments that may better maintain protein folding.

  • Plant-based systems: For physiologically relevant post-translational modifications, expression in heterologous plant systems like Nicotiana benthamiana via Agrobacterium-mediated transformation can be employed.

The choice depends on whether native conformation, post-translational modifications, or high yield is prioritized .

What purification strategy yields the highest purity and activity for recombinant MTP2?

A multi-step purification strategy is recommended for recombinant MTP2:

  • Initial capture: Immobilized metal affinity chromatography (IMAC) using His-tag fusion proteins

  • Intermediate purification: Ion exchange chromatography

  • Polishing: Size exclusion chromatography

For membrane proteins like MTP2, detergent selection is critical. Begin with mild detergents like n-dodecyl-β-D-maltoside (DDM) during cell lysis and maintain throughout purification. Quality assessment should include SDS-PAGE, Western blotting, and activity assays that measure metal binding or transport capacity. For highest activity, avoid repeated freeze-thaw cycles as noted in recombinant protein handling guidelines .

How can researchers verify the proper folding and activity of purified recombinant MTP2?

Verification of proper folding and activity requires multiple approaches:

  • Circular dichroism (CD) spectroscopy: To assess secondary structure elements

  • Thermal shift assays: To evaluate protein stability

  • Metal-binding assays: Using isothermal titration calorimetry (ITC) or microscale thermophoresis (MST)

  • Transport activity: Through reconstitution in liposomes or proteoliposomes and measuring metal flux

Additionally, researchers should compare activity with known standards using bioassays similar to those described for other recombinant proteins, recognizing that specific activity measurements may vary between laboratories . Activity should be expressed as a specific activity (units/mg) calculated using the formula: Specific Activity = 1 × 10⁶ / ED₅₀ (ng/ml) .

What experimental approaches best determine MTP2 metal substrate specificity?

Determining metal substrate specificity for rice MTP2 requires complementary approaches:

TechniqueAdvantagesLimitationsData Output
Yeast Complementation AssaysIn vivo functional assessmentEnvironmental variationsGrowth rescue phenotypes
Radioactive Metal UptakeDirect quantificationSafety considerationsTransport kinetics (Km, Vmax)
ICP-MS AnalysisMulti-element detectionExpensive equipmentPrecise metal concentrations
Fluorescent Metal ProbesReal-time visualizationProbe availabilitySubcellular localization

For comprehensive characterization, test MTP2 activity across a concentration gradient of metals (Zn, Fe, Mn, Cd) similar to experiments performed with peanut MTP genes . Compare wild-type and site-directed mutants to identify critical residues for substrate discrimination, as metal selectivity often depends on specific amino acid coordination spheres in the protein structure.

How does MTP2 expression change in response to different metal stresses in rice?

Based on studies of metal tolerance genes in plants, MTP2 expression in rice likely shows metal-specific responses. In comparable studies on peanut MTPs, excess Fe upregulated certain MTP genes . For rice MTP2, researchers should:

  • Expose rice plants to varied concentrations of metals (0.1-1.0 mM of Fe, Zn, Cd, Mn)

  • Collect tissue samples at multiple time points (6h, 24h, 48h, 72h)

  • Analyze expression using qRT-PCR with appropriate reference genes (e.g., rice 60S)

  • Calculate relative expression using the 2^(-ΔΔCT) method

Researchers should note that MTP2 expression patterns may differ between rice cultivars with varying metal tolerance levels, similar to observations in peanut cultivars Fenghua 1 and Silihong that showed distinct responses to metals .

What protein-protein interactions are critical for MTP2 function in metal homeostasis?

MTP2 likely operates within a complex network of protein interactions that modulate its function. To identify these interactions:

  • Yeast two-hybrid screening: To identify potential interacting partners

  • Co-immunoprecipitation followed by mass spectrometry: To verify interactions in planta

  • Bimolecular fluorescence complementation (BiFC): To visualize interactions in vivo

  • Surface plasmon resonance (SPR): To determine binding kinetics

Key interaction partners may include other transporters, metal chaperones, and regulatory proteins. In rice PTI signaling, proteins like OsRLCK185 mediate responses through MAPK cascades , suggesting similar signaling networks might regulate MTP2 function during stress. Focus on interactions that change dynamically under different metal stress conditions, as these may represent regulatory mechanisms.

How can recombinant MTP2 be used to understand rice responses to multiple metal stresses?

Recombinant MTP2 serves as a powerful tool for investigating rice metal stress responses:

  • In vitro transport studies: Reconstitute purified MTP2 in artificial membranes to measure transport capacity for different metals under varying pH and redox conditions.

  • Structural studies: Use recombinant MTP2 for crystallography or cryo-EM studies to determine metal binding sites and conformational changes during transport.

  • Antibody production: Generate antibodies against recombinant MTP2 to track endogenous protein levels in different rice tissues under stress conditions.

  • Comparative proteomics: Use MTP2 as a bait protein in pull-down assays to identify stress-specific interaction partners.

Similar to MSP1-triggered responses in rice , MTP2-mediated responses likely involve complex signaling networks that can be mapped using transcriptomic and proteomic approaches to identify downstream components.

What role does MTP2 play in cross-tolerance to different abiotic stresses?

Metal tolerance proteins often contribute to broader stress tolerance mechanisms beyond their primary metal transport functions. To investigate MTP2's role in cross-tolerance:

  • Subject rice plants with altered MTP2 expression (overexpression or knockdown) to multiple stresses sequentially or simultaneously:

    • Metal stress + drought

    • Metal stress + salinity

    • Metal stress + extreme temperatures

  • Measure physiological parameters including:

    • Photosynthetic efficiency

    • Reactive oxygen species (ROS) accumulation

    • Stress hormone levels (ABA, ethylene, jasmonic acid)

    • Antioxidant enzyme activities

MTP2 may influence these processes similarly to how MSP1 treatment affects photosynthesis, secondary metabolism, and signaling pathways in rice . Cross-tolerance mechanisms often involve shared signaling components, particularly in hormone and ROS signaling networks.

How does tissue-specific expression of MTP2 correlate with metal partitioning in rice?

Understanding the relationship between MTP2 expression patterns and metal distribution requires:

  • Tissue-specific expression analysis: Use laser capture microdissection coupled with qRT-PCR to quantify MTP2 expression in specific cell types.

  • Metal localization studies: Employ synchrotron X-ray fluorescence microscopy to map metal distribution at the tissue level.

  • Translocation analysis: Calculate metal translocation factors using the equation:
    Metal translocation (%) = (Metal content in shoots / Total metal content) × 100

  • Reporter gene fusions: Create MTP2 promoter::GUS/GFP constructs to visualize expression patterns.

Compare data from contrasting rice cultivars with different metal accumulation tendencies, similar to the approach used with peanut cultivars that showed differential metal tolerance . This will reveal how MTP2 expression patterns influence root-to-shoot metal translocation, which is critical for developing rice varieties with improved metal tolerance.

What CRISPR/Cas9 strategies are most effective for studying MTP2 function in rice?

For precise genetic manipulation of MTP2 in rice:

  • Knockout strategy: Design sgRNAs targeting conserved transmembrane domains or metal binding motifs. Use multiple guides to ensure complete gene disruption.

  • Base editing: For studying specific amino acid contributions to metal selectivity, employ cytosine or adenine base editors to create point mutations without double-strand breaks.

  • Prime editing: For more complex edits, use prime editing to precisely modify metal coordination sites with minimal off-target effects.

  • Promoter editing: To study regulation, target the MTP2 promoter to alter expression patterns rather than protein sequence.

For delivery, Agrobacterium-mediated transformation of rice callus typically yields higher efficiency than direct DNA delivery methods. Screen transformants using a combination of PCR, sequencing, and protein expression analysis to identify lines with desired modifications.

How can heterologous expression systems be optimized for structure-function studies of rice MTP2?

For structure-function studies:

  • Construct design optimization:

    • Include affinity tags (His, FLAG) for purification

    • Consider fusion with fluorescent proteins (GFP, mCherry) for localization studies

    • Add cleavable tags that don't interfere with function

    • Create truncated versions to identify minimal functional domains

  • Expression host selection:

    • For membrane proteins like MTP2, consider specialized hosts like E. coli Lemo21(DE3)

    • For eukaryotic expression, insect cells (Sf9, High Five) often provide better folding

    • C41/C43 E. coli strains are engineered for membrane protein expression

  • Purification refinement:

    • Use fluorescence-detection size exclusion chromatography (FSEC) to assess protein behavior

    • Test multiple detergents (DDM, LMNG, GDN) for optimal extraction and stability

    • Consider nanodiscs or SMALPs for native-like membrane environments

The expression system should be chosen based on downstream applications, with bacterial systems providing high yields for biochemical studies and eukaryotic systems offering appropriate post-translational modifications for functional studies.

What transcriptomic approaches provide insights into MTP2-regulated pathways during metal stress?

Advanced transcriptomic approaches for studying MTP2-regulated pathways include:

  • Time-course RNA-seq: Analyze transcriptome changes at multiple time points (6h, 24h, 48h) after metal exposure, similar to MSP1 studies that revealed time-dependent transcriptional responses in rice .

  • Single-cell RNA-seq: Apply to root tips and developing tissues to capture cell-specific responses to metal stress that may be masked in bulk tissue analysis.

  • Comparative transcriptomics: Compare wild-type with MTP2 overexpression and knockout lines under metal stress to identify:

    • Differentially expressed genes

    • Enriched pathways

    • Transcription factor networks

  • Co-expression network analysis: Identify genes with expression patterns correlated with MTP2 to discover functional modules.

Analysis should focus on pathways similar to those affected by MSP1 treatment, including photosynthesis, secondary metabolism, lipid metabolism, protein synthesis/degradation, and hormone signaling . Special attention should be given to receptor-like kinases (RLKs), MAPKs, and WRKY transcription factors that may form signaling cascades downstream of MTP2 activity.

What are common challenges in recombinant MTP2 expression and how can they be addressed?

Researchers commonly encounter several challenges when expressing recombinant MTP2:

ChallengePotential SolutionImplementation Notes
Poor expression yieldOptimize codon usage for host; lower expression temperature (16-18°C)Extends expression time to 24-48 hours
Protein aggregationAdd solubilization agents (glycerol, arginine); screen detergent panelStart with 10% glycerol and test DDM, LMNG concentrations
DegradationInclude protease inhibitors; express as fusion with stabilizing partnersConsider MBP, SUMO, or Mistic fusion tags
Loss of activityMaintain reducing environment; add metal ions during purificationInclude 1-5 mM DTT or BME; supplement with Zn²⁺
Limited solubilityOptimize buffer conditions (pH, salt, additives)Screen pH 6.0-8.0 and NaCl 100-500 mM

For membrane proteins like MTP2, if nothing is visible in the product vial after purification, this may be normal as noted in recombinant protein FAQs . Centrifuge the vial before opening to ensure the product is not near the cap, and follow reconstitution instructions carefully.

How can metal transport activity assays for MTP2 be standardized and validated?

Standardizing metal transport assays for MTP2 requires:

  • Reference standards: Establish laboratory reference standards with consistent activity, similar to International Units for other proteins .

  • Assay validation parameters:

    • Linearity: Test across concentration ranges

    • Precision: Intra-assay and inter-assay variability <15%

    • Specificity: Rule out non-specific transport

    • Robustness: Test with different buffer conditions

  • Controls:

    • Positive control: Well-characterized metal transporter

    • Negative control: Inactive MTP2 mutant

    • System control: Non-specific leakage measurement

  • Reporting format:

    • Express activity as specific activity (units/mg) calculated using ED₅₀ values

    • Include detailed methodology to allow comparison between labs

Remember that specific activity units are not the same as International Units (IU/mg), which would require validation against WHO standards . For MTP2, establish in-house units that can be compared across experiments within your laboratory.

What approaches help resolve contradictory data in MTP2 localization and function studies?

When facing contradictory data about MTP2 localization and function:

  • Validate antibodies:

    • Test antibody specificity using recombinant protein

    • Include MTP2 knockout tissues as negative controls

    • Consider epitope masking in different cellular contexts

  • Employ multiple localization methods:

    • Fluorescent protein fusions

    • Immunolocalization

    • Subcellular fractionation followed by Western blotting

    • Proximity labeling (BioID, APEX)

  • Context considerations:

    • Test different developmental stages

    • Examine multiple tissues

    • Vary metal stress conditions

    • Consider post-translational modifications affecting localization

  • Reconcile functional data:

    • Compare in vitro vs. in vivo results

    • Assess differences between heterologous and native systems

    • Consider redundancy with other transporters

    • Evaluate temporal dynamics of transport activity

Contradictions often arise from differences in experimental conditions or developmental context. Document all variables thoroughly to identify patterns explaining apparent contradictions.

How should researchers interpret changes in MTP2 expression in relation to metal accumulation data?

To properly interpret the relationship between MTP2 expression and metal accumulation:

  • Correlation analysis: Calculate Pearson or Spearman correlation coefficients between MTP2 expression levels and metal content in different tissues. Analyze both absolute metal concentrations and translocation factors .

  • Time-dependent relationships: Recognize that expression changes may precede measurable changes in metal accumulation. Plot time-course data to identify lead-lag relationships.

  • Dose-response considerations: Analyze how different metal concentrations affect the expression-accumulation relationship. Non-linear relationships may indicate regulatory thresholds.

  • Multi-gene interactions: Consider that MTP2 likely functions within a network of transporters. Use multiple regression or principal component analysis to account for other genes' contributions.

  • Cultivar differences: Compare data across cultivars with known differences in metal tolerance, similar to the approach used with peanut cultivars Fenghua 1 and Silihong .

What statistical approaches are appropriate for analyzing MTP2 functional genomics datasets?

For robust statistical analysis of MTP2 functional genomics data:

  • Differential expression analysis:

    • For RNA-seq: Apply DESeq2 or edgeR with FDR correction

    • For qRT-PCR: Use the 2^(-ΔΔCT) method with appropriate reference genes

    • Set significance thresholds at adjusted p < 0.05 and fold change > 2

  • Enrichment analysis:

    • Gene Ontology (GO) enrichment to identify biological processes

    • KEGG pathway analysis to uncover affected metabolic pathways

    • Gene Set Enrichment Analysis (GSEA) for detecting subtle but coordinated changes

  • Network analysis:

    • Weighted Gene Co-expression Network Analysis (WGCNA)

    • Protein-protein interaction networks from experimental data

    • Regulatory network inference

  • Multivariate approaches:

    • Principal Component Analysis (PCA) to visualize major sources of variation

    • Partial Least Squares Discriminant Analysis (PLS-DA) for identifying discriminating variables

    • ANOVA-simultaneous component analysis (ASCA) for multi-factor experiments

For time-series data, consider specialized methods like maSigPro or impulseDE2 that account for temporal dependencies, as significant expression changes may occur at specific timepoints (e.g., more intense responses at 24h compared to 6h post-treatment) .

How can structural bioinformatics enhance understanding of MTP2 metal transport mechanisms?

Structural bioinformatics approaches offer valuable insights into MTP2 function:

  • Homology modeling:

    • Use solved structures of bacterial CDF transporters as templates

    • Validate models using PROCHECK, VERIFY3D, and ProSA

    • Refine models in explicit membrane environments

  • Molecular dynamics simulations:

    • Simulate MTP2 in lipid bilayers to assess conformational changes

    • Investigate metal ion coordination in transport sites

    • Analyze water-mediated hydrogen bond networks in transport pathways

  • Docking studies:

    • Dock different metal ions to identify selective binding sites

    • Screen for potential inhibitors or activators

    • Predict the impact of mutations on metal binding

  • Evolutionary analysis:

    • Perform ConSurf analysis to identify evolutionarily conserved residues

    • Compare MTP2 sequences across rice varieties and related species

    • Identify residues under positive selection that may confer specific adaptations

These computational approaches can generate testable hypotheses about transport mechanisms, guide mutagenesis experiments, and help interpret experimental data in a structural context.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.