Recombinant Oryza sativa subsp. japonica Metal tolerance protein 3 (MTP3)

Shipped with Ice Packs
In Stock

Description

Protein Overview

MTP3 (UniProt ID: Q6Z7K5) belongs to the cation diffusion facilitator (CDF) transporter family, specifically the SLC30A subfamily. It is encoded by the MTP3 gene (locus names include LOC4330894, Os02g0775100, and OsJ_08570) and shares structural homology with other metal-tolerance proteins like MTP1 and MTP8 .

PropertyDetail
Gene NamesMTP3, LOC4330894, Os02g0775100, OsJ_08570, OJ1448_G06.19
Protein Length410 amino acids (full-length)
FamilyCDF transporter (TC 2.A.4), SLC30A subfamily
FunctionSequestration of excess metals (e.g., Zn, Cd) into vacuoles

Reconstitution:

  • Recommended concentration: 0.1–1.0 mg/mL in deionized water.

  • Optional addition of 5–50% glycerol for long-term stability .

Biological Function

MTP3 facilitates metal ion transport by binding and translocating ions into vacuoles, mitigating cytoplasmic toxicity. Key functional insights include:

Mechanism of Action

  • CDF Family Role: Utilizes proton motive force to transport divalent cations (e.g., Zn²⁺, Cd²⁺) into vacuoles .

  • Interaction Network: Predicted functional partners include MTP8 (score: 0.586) and MTP1 (score: 0.473), suggesting coordinated metal detoxification .

Partner ProteinFunctionInteraction Score
MTP8Metal sequestration0.586
MTP1Zinc homeostasis0.473
SLC40A1Iron transport0.446

Research Applications

Recombinant MTP3 serves as a tool for studying metal tolerance mechanisms and biotechnological innovations:

ApplicationDetail
ELISA DevelopmentUsed in kits for quantifying MTP3 levels in plant samples
Metal Transport StudiesInvestigating substrate specificity (e.g., Zn, Cd) and transport kinetics
BioremediationEngineering crops with enhanced heavy metal uptake/sequestration

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format that we have in stock. However, if you have any specific requirements for the format, please indicate them when placing your order. We will prepare the product according to your request.
Lead Time
Delivery time may vary depending on the purchase method or location. Please consult your local distributors for specific delivery timeframes.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance. Additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers may use this as a reference.
Shelf Life
The shelf life is influenced by various factors including storage conditions, buffer ingredients, temperature, and the protein's inherent stability.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The shelf life of the lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production. If you have a specific tag type in mind, please inform us, and we will prioritize developing the specified tag.
Synonyms
MTP3; Os02g0775100; LOC_Os02g53490; OJ1448_G06.19; OsJ_08570; Metal tolerance protein 3; OsMTP3
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-410
Protein Length
full length protein
Species
Oryza sativa subsp. japonica (Rice)
Target Names
MTP3
Target Protein Sequence
MDGDDRRTPLLGGEGGSTRPPSLRRRDSARSLRSTFLSRLPDKVRGGGDPERPAADVDLT RAKGLSQGEKEYYEKQLATLKIFEEVEALCMPGEFESDAEVLELEDKEQKQSESAMKISN YANIILLVFKVYATIKTGSMAIAASTLDSLLDFLAGGILYFTHLTMKSVNIYKYPIGKLR VQPVGIIVFAAIMATLGFQVLIQAIEQLVENKAGEKMTPEQLIWLYSIMLSATVVKLALY IYCRSSGNSIVQAYAKDHYFDVVTNVVGLVAAVLGDKFFWWIDPVGAVLLAVYTIVNWSG TVYENAVTLVGQCAPSDMLQKLTYLAMKHDPRVRRVDTVRAYSFGALYFVEVDIELSEDM RLGEAHSIGESLQDKIEKLPEVERAFVHVDFESTHKPEHRVRSRLPSTEP
Uniprot No.

Target Background

Function
Metal tolerance protein 3 (MTP3) plays a crucial role in sequestering excess metal within the cytoplasm into vacuoles, maintaining metal homeostasis.
Database Links
Protein Families
Cation diffusion facilitator (CDF) transporter (TC 2.A.4) family, SLC30A subfamily
Subcellular Location
Vacuole membrane; Multi-pass membrane protein. Note=Tonoplast.

Q&A

What is Metal Tolerance Protein 3 (MTP3) and what is its primary function in rice?

Metal Tolerance Protein 3 (MTP3) in rice is a member of the Cation Diffusion Facilitator (CDF) family that primarily functions in metal ion homeostasis, particularly for zinc (Zn²⁺). Similar to its Arabidopsis homolog AtMTP3, rice MTP3 likely contributes to basic cellular Zn tolerance by mediating the compartmentalization or exclusion of excess Zn. Based on findings from Arabidopsis, MTP3 appears to play a critical role in controlling zinc partitioning between roots and shoots, particularly under conditions of high zinc influx or iron deficiency . The protein likely functions as a transporter that sequesters excess zinc into vacuoles or other cellular compartments to prevent toxicity.

Where is MTP3 typically localized in plant cells?

Based on studies of the Arabidopsis homolog, MTP3 is typically localized to the vacuolar membrane (tonoplast). When AtMTP3-GFP fusion proteins were expressed in Arabidopsis, they were observed at the vacuolar membrane . This subcellular localization is consistent with its proposed function in sequestering excess zinc into vacuoles to maintain cytoplasmic zinc concentrations within an optimal range. In rice, MTP3 is likely to have a similar vacuolar localization, though specific localization studies in rice cells would be needed for confirmation.

What conditions induce MTP3 expression in plants?

MTP3 expression is strongly induced under specific stress conditions. In Arabidopsis, AtMTP3 expression is upregulated in response to:

  • High but non-toxic concentrations of zinc

  • Cobalt exposure

  • Iron deficiency

The gene is specifically induced in epidermal and cortex cells of the root hair zone under these conditions . This expression pattern suggests that MTP3 plays a role in the adaptive response to metal stress and nutrient imbalances. Similar induction patterns might be expected in rice MTP3, particularly in response to excess zinc or iron deficiency conditions.

How can I clone and express recombinant rice MTP3 for functional studies?

To clone and express recombinant rice MTP3:

  • Gene isolation: Extract total RNA from rice tissues (preferably from zinc-stressed plants to ensure adequate expression). Perform RT-PCR using primers specific to rice MTP3 coding sequence.

  • Cloning strategy: Insert the amplified MTP3 cDNA into an appropriate expression vector:

    • For plant expression: Use vectors with strong constitutive promoters (e.g., CaMV 35S) or inducible promoters.

    • For bacterial expression: Use pET or pGEX vectors with appropriate tags (His, GST) for purification.

    • For yeast expression: Consider vectors like pYES2 or pRS series, especially for complementation studies.

  • Expression systems:

    • Heterologous expression in yeast mutants (e.g., zrc1 cot1 mutant) can restore metal tolerance and demonstrate functional conservation .

    • E. coli expression systems may be used for protein purification, though membrane proteins can be challenging.

    • Plant expression systems, including Arabidopsis or rice cell cultures, provide a more native environment for functional studies.

  • Protein verification: Confirm expression using Western blotting with antibodies against either MTP3 or fusion tags.

What methodologies are recommended for studying MTP3 localization in rice cells?

For studying MTP3 subcellular localization in rice:

  • Fluorescent protein fusions: Create MTP3-GFP (or other fluorescent protein) fusion constructs. This approach has been successfully used with AtMTP3 and revealed its vacuolar membrane localization .

  • Expression systems:

    • Transient expression in rice protoplasts

    • Stable transformation in rice

    • Heterologous expression in Arabidopsis (if rice transformation is challenging)

  • Confocal microscopy techniques:

    • Co-localization with known tonoplast markers

    • Z-stack imaging to distinguish between plasma membrane and tonoplast

    • Time-lapse imaging for dynamic studies

  • Immunogold electron microscopy: For high-resolution localization, use MTP3-specific antibodies coupled with gold particles for visualization under transmission electron microscopy.

  • Subcellular fractionation: Isolate vacuolar membranes and other subcellular fractions, followed by Western blotting to detect native MTP3.

What are the best methods for analyzing metal tolerance phenotypes in transgenic plants expressing MTP3?

To analyze metal tolerance phenotypes in MTP3 transgenic plants:

  • Metal stress experiments:

    • Hydroponic culture with controlled zinc concentrations (from deficient to toxic)

    • Soil experiments with zinc amendments

    • Combined stress treatments (e.g., zinc excess with iron deficiency)

  • Phenotypic analyses:

    • Root and shoot growth measurements

    • Chlorophyll content determination

    • Fresh and dry weight analyses

    • Seed yield and quality assessment

  • Metal content analyses:

    • ICP-MS (Inductively Coupled Plasma Mass Spectrometry) for precise quantification of metal content in different tissues

    • Zinpyr-1 fluorescent staining for zinc localization in tissues

    • Synchrotron X-ray fluorescence for spatial distribution of metals

  • Physiological and biochemical assays:

    • Photosynthetic efficiency measurements

    • ROS detection and antioxidant enzyme activity

    • Metal-responsive gene expression analysis

  • Comparison to control lines:

    • Wild-type plants

    • MTP3 knockout/knockdown lines

    • Plants overexpressing MTP3

How can CRISPR/Cas9 be used to study MTP3 function in rice?

CRISPR/Cas9 genome editing can be a powerful approach for studying MTP3 function in rice:

  • Target design strategy:

    • Design guide RNAs targeting exonic regions of MTP3, preferably in conserved functional domains

    • Target multiple sites to increase knockout efficiency

    • Use published rice genome data to ensure specificity and avoid off-target effects

  • Delivery methods:

    • Agrobacterium-mediated transformation of rice calli

    • Protoplast transformation for initial validation

    • Biolistic delivery in recalcitrant genotypes

  • Mutation screening approaches:

    • T7 Endonuclease I assay for initial detection

    • CAPS (Cleaved Amplified Polymorphic Sequences) assay if appropriate restriction sites are present

    • Direct sequencing of PCR products

    • High-resolution melting analysis

  • Phenotypic characterization:

    • Metal tolerance assays comparing edited lines to wild-type

    • Metal distribution analyses using ICP-MS

    • Transcriptomic analyses to identify compensatory mechanisms

  • Complementation studies:

    • Reintroduce wild-type MTP3 or mutated versions to confirm phenotype-genotype relationships

    • Use tissue-specific or inducible promoters for spatial and temporal studies

What approaches can be used to study metal transport activity of recombinant rice MTP3?

To study the metal transport activity of rice MTP3:

  • Heterologous expression systems:

    • Yeast complementation: Express rice MTP3 in zinc-sensitive yeast mutants (e.g., zrc1 cot1) and test for restored tolerance to zinc and other metals

    • Xenopus oocytes: Inject MTP3 cRNA for electrophysiological studies

    • Vesicle transport assays: Measure metal uptake in isolated vesicles from expression systems

  • Radioactive metal uptake assays:

    • Use ⁶⁵Zn, ⁵⁴Mn, or other isotopes to directly measure transport

    • Compare transport rates in MTP3-expressing cells versus controls

    • Perform competition assays with different metals to determine specificity

  • Fluorescent metal indicators:

    • Use zinc-specific fluorescent probes (FluoZin-3, Zinpyr-1) to monitor subcellular zinc redistribution

    • Perform time-course studies to determine transport kinetics

  • Site-directed mutagenesis:

    • Mutate key residues predicted to be involved in metal binding or transport

    • Compare transport activity of wild-type and mutant proteins

    • Develop structure-function relationships

  • Transport kinetics analysis:

    • Determine Km and Vmax values for different metal substrates

    • Study the effects of pH, temperature, and other ions on transport activity

How does MTP3 interaction with other proteins influence its function in metal homeostasis?

MTP3 likely functions in coordination with other proteins to maintain metal homeostasis:

  • Protein-protein interaction methods:

    • Yeast two-hybrid screening to identify potential interactors

    • Co-immunoprecipitation followed by mass spectrometry

    • Bimolecular fluorescence complementation (BiFC) for in vivo interaction verification

    • FRET (Förster Resonance Energy Transfer) for dynamic interaction studies

  • Potential interaction partners:

    • Other metal transporters (ZIP, HMA, NRAMP families)

    • Metal-binding proteins and metallochaperones

    • Regulatory proteins involved in metal sensing

    • Vesicular trafficking components

  • Interaction effects on function:

    • Transport activity assays in the presence of identified interactors

    • Localization studies to determine if interactions affect subcellular targeting

    • Metal tolerance phenotypes in plants with altered expression of interaction partners

  • Signaling pathway integration:

    • Phosphoproteomics to identify potential regulatory phosphorylation sites

    • Studies on the effects of kinase inhibitors on MTP3 function

    • Investigation of metal-responsive transcription factors that regulate MTP3 and its partners

What are common challenges in expressing functional recombinant MTP3 and how can they be overcome?

Membrane proteins like MTP3 present several challenges for recombinant expression:

  • Expression level issues:

    • Problem: Low expression levels in heterologous systems.

    • Solution: Optimize codon usage for the host organism; use strong inducible promoters; try different expression hosts (E. coli, yeast, insect cells); adjust induction conditions (temperature, inducer concentration, timing).

  • Protein folding and stability:

    • Problem: Misfolding or aggregation of recombinant MTP3.

    • Solution: Express at lower temperatures (16-20°C); include molecular chaperones; use fusion partners that enhance solubility (MBP, SUMO); add stabilizing agents during purification.

  • Membrane incorporation:

    • Problem: Poor incorporation into host membranes.

    • Solution: Use specialized E. coli strains (C41, C43) designed for membrane protein expression; consider cell-free expression systems with added liposomes or nanodiscs.

  • Functional verification:

    • Problem: Difficulty confirming if recombinant protein is functional.

    • Solution: Complement yeast metal transport mutants as a functional assay ; use fluorescent metal indicators to track transport; develop robust in vitro transport assays.

  • Purification challenges:

    • Problem: Maintaining stability during extraction from membranes.

    • Solution: Screen multiple detergents; use gentle solubilization conditions; purify in the presence of stabilizing lipids; consider nanodiscs or amphipols for stabilization after purification.

How can I analyze contradictory data regarding MTP3 metal specificity?

When facing contradictory results regarding MTP3 metal specificity:

  • Systematic methodology comparison:

    • Compare experimental conditions (pH, temperature, buffer composition)

    • Evaluate differences in expression systems used

    • Assess the methods used to measure metal transport or binding

  • Metal competition experiments:

    • Design experiments where multiple metals compete for transport

    • Determine relative affinities through concentration-dependent competition

    • Compare results across different experimental systems

  • Domain-specific analysis:

    • Examine if different structural domains have different metal preferences

    • Create chimeric proteins with domains from related transporters

    • Use site-directed mutagenesis to alter key metal-binding residues

  • Physiological relevance assessment:

    • Correlate in vitro metal specificity with in vivo phenotypes

    • Measure actual metal accumulation patterns in transgenic plants

    • Consider that primary and secondary substrates may exist

  • Meta-analysis approach:

    • Systematically compare your results with published literature

    • Weight evidence based on methodological robustness

    • Consider that apparent contradictions may reflect biological complexity rather than experimental error

What statistical approaches are most appropriate for analyzing MTP3 expression data under different metal stress conditions?

For analyzing MTP3 expression data under various metal stress conditions:

  • Normalization considerations:

    • Use multiple reference genes that are stable under metal stress conditions

    • Apply geometric averaging of reference genes (e.g., geNorm method)

    • Consider global normalization methods for RNA-seq data

  • Statistical tests for expression comparisons:

    • ANOVA followed by post-hoc tests (Tukey, Bonferroni) for multiple treatment comparisons

    • Student's t-test for simple pairwise comparisons

    • Non-parametric alternatives (Mann-Whitney, Kruskal-Wallis) if data doesn't meet parametric assumptions

  • Dose-response modeling:

    • Fit expression data to dose-response curves

    • Determine EC50 values for different metals

    • Compare curve parameters across treatments and genotypes

  • Time-course analysis:

    • Repeated measures ANOVA for time series data

    • Functional data analysis for continuous expression profiles

    • Clustering approaches to identify co-regulated genes

  • Multivariate analysis for complex datasets:

    • Principal Component Analysis (PCA) to visualize major patterns

    • Partial Least Squares Discriminant Analysis (PLS-DA) for treatment discrimination

    • Hierarchical clustering to identify groups of conditions with similar effects

How does rice MTP3 compare functionally to MTP3 proteins in other plant species?

A comparative analysis of MTP3 proteins across plant species reveals important functional insights:

SpeciesLocalizationPrimary MetalsExpression PatternPhenotypic Effects
Oryza sativa (rice)Predicted vacuolar membranePrimarily ZnLikely induced by Zn excess and Fe deficiencyPresumed role in Zn sequestration and partitioning
Arabidopsis thalianaVacuolar membraneZn, CoInduced in root epidermis and cortex under Zn/Co excess and Fe deficiencyControls Zn partitioning between roots and shoots
Hordeum vulgare (barley)Vacuolar membraneZnInduced by Zn stressContributes to Zn tolerance in shoots
Medicago truncatulaVacuolar membraneZn, possibly MnExpressed in roots, nodulesRole in symbiotic nitrogen fixation and metal homeostasis

The functional analysis of MTP3 shows conservation of the primary role in zinc tolerance across species, but with species-specific adaptations:

  • Conserved mechanisms:

    • Vacuolar localization for metal sequestration

    • Induction under excess metal conditions

    • Role in controlling metal partitioning between tissues

  • Species-specific differences:

    • Metal specificity profiles may vary slightly

    • Tissue-specific expression patterns reflect adaptation to different ecological niches

    • Regulatory mechanisms may differ between monocots and dicots

  • Evolutionary implications:

    • MTP3 likely evolved as a specific mechanism for zinc detoxification

    • The response to iron deficiency suggests co-evolution with iron homeostasis mechanisms

    • Integration into species-specific metal homeostasis networks

How can phylogenetic analysis inform our understanding of rice MTP3 function?

Phylogenetic analysis provides valuable context for understanding rice MTP3 function:

  • Evolutionary relationships:

    • MTP3 belongs to the Zn-CDF subgroup of the Cation Diffusion Facilitator (CDF) family

    • Close phylogenetic relationship with AtMTP3 suggests functional conservation

    • Identification of key conserved domains that likely mediate metal transport

  • Sequence conservation analysis:

    • Highly conserved metal-binding sites across species indicate essential functional residues

    • Variable regions may correspond to species-specific regulatory mechanisms

    • Transmembrane domain conservation suggests similar transport mechanisms

  • Gene duplication patterns:

    • MTP gene family expansion through duplication events

    • Potential subfunctionalization or neofunctionalization after duplication

    • Rice-specific duplications may indicate specialized roles in cereals

  • Selection pressure analysis:

    • Identification of positively selected sites that may confer adaptive advantages

    • Conservation patterns that reflect functional constraints

    • Correlation between selection patterns and metal exposure in different habitats

  • Functional prediction:

    • Using knowledge from well-characterized homologs to predict rice MTP3 function

    • Identifying potentially unique features of rice MTP3 for experimental verification

    • Guiding mutagenesis studies to focus on evolutionarily significant residues

What can we learn from integrating transcriptomic and proteomic data about MTP3's role in the broader metal homeostasis network?

Integrating -omics data provides a systems-level understanding of MTP3 function:

  • Co-expression network analysis:

    • Identification of genes consistently co-regulated with MTP3

    • Construction of metal homeostasis modules within the transcriptional network

    • Inference of shared regulatory mechanisms and transcription factors

  • Comparative transcriptomics across conditions:

    • Metal-specific transcriptional responses involving MTP3

    • Temporal dynamics of MTP3 expression relative to other metal homeostasis genes

    • Cross-talk between different metal stress responses (e.g., Zn excess and Fe deficiency)

  • Proteome-level interactions:

    • Identification of proteins physically interacting with MTP3

    • Post-translational modifications affecting MTP3 function

    • Protein complex formation under different metal stress conditions

  • Metabolomic correlations:

    • Changes in metal-related metabolites (e.g., nicotianamine, phytochelatins) in relation to MTP3 expression

    • Metabolic adaptations to metal stress that may involve MTP3

  • Integrative models:

    • Pathway modeling that places MTP3 in the context of cellular metal trafficking

    • Predictive models of plant responses to varying metal availability

    • Identification of key regulatory nodes that could be targeted for crop improvement

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.