Recombinant Oryza sativa subsp. japonica Metal tolerance protein 4 (MTP4)

Shipped with Ice Packs
In Stock

Description

  • Reconstitution requires deionized water and glycerol (5–50% final concentration) .

  • Purity validated via SDS-PAGE .

Functional Characteristics

MTP4 plays a pivotal role in metal ion transport and detoxification:

Mechanism:

  • Sequesters excess cytoplasmic metals (e.g., Zn²⁺, Cd²⁺) into vacuoles .

  • Maintains cellular metal homeostasis under stress conditions .

Biochemical Features:

  • pH Stability: Functions optimally in Tris/PBS-based buffers (pH 8.0) .

  • Thermal Stability: Requires storage at -80°C for long-term integrity .

Evolutionary Context:

  • Shares functional domains with Arabidopsis thaliana CDF proteins but exhibits lineage-specific adaptations .

Research Applications

Recombinant MTP4 is utilized in:

  1. Metal Tolerance Studies: Elucidating transport kinetics and substrate specificity .

  2. Transgenic Crop Development: Engineering metal-hyperaccumulating rice varieties for phytoremediation .

  3. Protein Interaction Assays: Identifying binding partners via co-IP or yeast two-hybrid systems .

Challenges and Future Directions

  • Limitations: Lack of post-translational modifications in prokaryotic systems may affect functional studies .

  • Opportunities: CRISPR-based editing of MTP4 could enhance rice resilience to heavy metal pollution .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please specify them during order placement. We will fulfill your request as best as possible.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please contact your local distributor for specific delivery times.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%. Customers may use this as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer composition, temperature, and the inherent stability of the protein.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
Tag type is determined during production. If you have a specific tag type requirement, please inform us. We will prioritize developing the specified tag if possible.
Synonyms
MTP4; Os03g0226400; LOC_Os03g12530; OsJ_09993; OSJNBa0081P02.21; Metal tolerance protein 4; OsMTP4
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-397
Protein Length
full length protein
Species
Oryza sativa subsp. japonica (Rice)
Target Names
MTP4
Target Protein Sequence
MEAKGENDARAPLLAERRRNSVGSMRGEFVSRLPKKVLDAVDPERPSHVDFSRSKGLREG EKEYYEKQFATLRSFEEVDSIEESNVMSEEDDIAEQKQSEFAMKISNYANMILLALKIYA TIKSGSIAIAASTLDSLLDLMAGGILWFTHLSMKSINVYKYPIGKLRVQPVGIIIFAAVM ATLGFQVFVQAVEKLIVNETPDKLTPVQLTWLYSIMIFATVVKLALWLYCRTSGNKIVRA YAKDHYFDVVTNVVGLAAAVLGDMFYWWIDPVGAIALAVYTITNWSGTVWENAVSLVGES APPEMLQKLTYLAIRHHPQIKRVDTVRAYTFGVLYFVEVDIELPEELPLKEAHAIGESLQ IKIEELPEVERAFVHLDFECDHKPEHNILSKLPSSQP
Uniprot No.

Target Background

Function
Metal tolerance protein 4 (MTP4) is involved in the sequestration of excess metal from the cytoplasm into vacuoles, thereby maintaining metal homeostasis.
Database Links
Protein Families
Cation diffusion facilitator (CDF) transporter (TC 2.A.4) family, SLC30A subfamily
Subcellular Location
Vacuole membrane; Multi-pass membrane protein. Note=Tonoplast.

Q&A

What is Oryza sativa MTP4 and what is its function in rice plants?

Metal tolerance protein 4 (MTP4) from Oryza sativa subsp. japonica is a transmembrane protein belonging to the broader family of heavy metal-associated proteins (HMPs) that play crucial roles in plant stress responses. The protein consists of 397 amino acids and functions primarily in the sequestration and transport of heavy metals within plant cells, contributing to detoxification mechanisms . As part of the plant's adaptive response system, MTP4 helps maintain cellular homeostasis when exposed to potentially toxic metal concentrations.

The protein contains specific heavy metal-associated domains (HMA) that enable metal binding and trafficking across cellular compartments. Structurally, MTP4 is classified alongside other metal tolerance proteins based on shared domain characteristics, though each exhibits unique expression patterns and metal specificities . In rice, this protein represents an important component of the evolved defense mechanisms against environmental metal stress.

What expression patterns does MTP4 exhibit in different rice tissues?

Unlike some constitutively expressed genes, MTP4 shows tissue-specific expression patterns in rice plants. Based on expression profile analyses of heavy metal-associated proteins in rice, most OsHMPs (including MTP4) demonstrate differential expression across various tissues, particularly in response to heavy metal stress conditions . While some OsHMPs are constitutively expressed across all rice tissues, MTP4's expression is more specialized and stress-responsive.

The expression profile varies depending on the type of heavy metal stress, with different metals inducing distinct expression patterns. This tissue-specific and stress-dependent expression suggests MTP4 has evolved specialized functions in particular plant organs, likely corresponding to the predominant sites of metal accumulation or sensitivity in rice plants . Researchers should consider these differential expression patterns when designing experiments to study MTP4 function in specific tissues or under various stress conditions.

What experimental design considerations are critical when studying MTP4 function?

When designing experiments to investigate MTP4 function, researchers should follow systematic experimental design principles while addressing the specific challenges of studying transmembrane proteins involved in stress responses. Begin by clearly defining independent variables (e.g., metal concentrations, exposure time) and dependent variables (e.g., MTP4 expression levels, plant growth parameters, metal content in tissues) .

A robust experimental design should include:

  • Control groups: Include both negative controls (no metal exposure) and positive controls (exposure to metals with known response patterns)

  • Dose-response relationships: Test multiple metal concentrations to establish threshold effects

  • Time-course measurements: Capture both immediate and adaptive responses

  • Tissue specificity: Sample different plant tissues to account for differential expression

  • Confounding variables: Control for environmental factors such as light, temperature, and other stressors that might influence metal uptake or tolerance

What are the best approaches for measuring MTP4 expression under heavy metal stress?

Accurately measuring MTP4 expression under heavy metal stress requires a combination of techniques to capture both transcriptional and translational responses. For comprehensive analysis, consider implementing the following methodological approach:

Transcriptional analysis:

  • qRT-PCR for targeted measurement of MTP4 mRNA levels using gene-specific primers

  • RNA-Seq for genome-wide expression profiling to place MTP4 in broader stress response networks

  • Time-course sampling to capture the dynamics of expression changes after metal exposure

Protein level analysis:

  • Western blotting using antibodies specific to MTP4 or its His-tag (if using recombinant protein)

  • Immunolocalization to determine spatial distribution within tissues and cells

  • Activity assays to correlate expression levels with functional metal transport capacity

When examining MTP4 expression specifically, consider that different heavy metals may induce variable expression patterns. For example, expression analysis in rice has shown that certain HMPs like OsHMP09, OsHMP18, and OsHMP22 demonstrated elevated expression across all tissues under various heavy metal stresses, while others showed more metal-specific or tissue-specific responses . Design your experiments to capture these potential variations in MTP4 expression patterns.

How should researchers handle and store recombinant MTP4 protein for experimental use?

Proper handling and storage of recombinant MTP4 is critical for maintaining protein integrity and experimental reproducibility. Based on established protocols for recombinant MTP4:

Storage conditions:

  • Store at -20°C for regular use

  • For extended storage, maintain at -20°C or -80°C to prevent degradation

  • Avoid repeated freeze-thaw cycles which can compromise protein structure and function

  • For working aliquots, store at 4°C for up to one week

Handling considerations:

  • The protein contains transmembrane domains that may affect solubility

  • The N-terminal 10xHis-tag should be considered when designing binding or interaction studies

  • The full-length protein (all 397 amino acids) is typically used for functional studies

Stability factors:

  • Shelf life varies depending on storage conditions: approximately 6 months for liquid form at -20°C/-80°C

  • Lyophilized form has extended stability (approximately 12 months at -20°C/-80°C)

  • Buffer composition significantly impacts protein stability

For optimal experimental outcomes, create small working aliquots to minimize freeze-thaw cycles, and validate protein integrity before critical experiments using techniques such as SDS-PAGE or circular dichroism if structural confirmation is necessary.

How does MTP4 compare functionally with other metal tolerance proteins in the MTP family?

MTP4 belongs to a larger family of metal tolerance proteins that differ in metal specificity, tissue expression, and subcellular localization. Comparative functional analysis reveals important distinctions within this protein family:

ProteinPrimary Metal SpecificityExpression PatternSubcellular LocalizationKey Structural Features
MTP4Multiple metalsTissue-specificTransmembraneHMA domains, 397 aa length
Other OsHMPsVariable (metal-specific)Some constitutive (e.g., OsHMP37), some tissue-specific (e.g., OsHMP28)VariableHMA domains with clade-specific variations

Unlike some constitutively expressed HMPs (such as OsHMP37, which shows high expression across tissues), MTP4 demonstrates more specialized expression patterns . The heavy metal-associated domain characteristics of MTP4 place it within specific phylogenetic clades that determine its metal-binding properties.

Functional analysis reveals that while some HMPs respond to specific metals, others like OsHMP09, OsHMP18, and OsHMP22 showed broad upregulation under various heavy metal stresses in multiple tissues . This suggests functional specialization within the MTP family, with MTP4 likely having evolved specific roles in metal tolerance that complement those of other family members.

What methodological approaches can differentiate between direct and indirect effects of MTP4 in heavy metal tolerance?

Distinguishing direct from indirect effects of MTP4 in heavy metal tolerance requires sophisticated experimental approaches that isolate MTP4 function while controlling for compensatory mechanisms. Consider implementing the following methodological framework:

Direct effect assessment:

  • In vitro metal binding assays: Using purified recombinant MTP4 protein to determine direct binding affinities for different metal ions

  • Transport assays in membrane vesicles: Reconstituting MTP4 in artificial membrane systems to measure metal transport capacity

  • Site-directed mutagenesis: Modifying specific amino acids in metal-binding domains to establish structure-function relationships

Indirect effect assessment:

  • Transcriptome analysis: Comparing global gene expression changes between wild-type and MTP4-modified plants under metal stress

  • Metabolomic profiling: Identifying downstream metabolic changes influenced by MTP4 activity

  • Protein-protein interaction studies: Identifying binding partners that may mediate indirect effects

Causal relationship verification:

  • Genetic complementation: Restoring MTP4 function in knockout/knockdown lines to confirm phenotype rescue

  • Heterologous expression: Expressing rice MTP4 in other organisms (e.g., yeast) to confirm its autonomous function

  • Time-resolved studies: Establishing the temporal sequence of biochemical events following metal exposure

This multi-faceted approach helps separate direct metal-binding and transport functions from secondary cellular responses, providing a more comprehensive understanding of MTP4's role in heavy metal tolerance mechanisms.

How can researchers effectively compare MTP4 functions across different plant species?

Comparative analysis of MTP4 across plant species provides valuable insights into evolutionary conservation and functional specialization of metal tolerance mechanisms. Implement the following systematic approach for cross-species comparisons:

Sequence-based comparisons:

  • Perform multiple sequence alignments of MTP4 orthologs across species, focusing on conserved domains and species-specific variations

  • Construct phylogenetic trees to establish evolutionary relationships between MTP4 variants

  • Analyze selection pressures on different protein regions to identify functionally critical domains

Functional comparisons:

  • Express MTP4 orthologs from different species in a common heterologous system (e.g., yeast mutants sensitive to metals)

  • Conduct complementation assays to determine functional equivalence or divergence

  • Measure metal-binding specificities and affinities of purified proteins from different species

Expression pattern comparisons:

  • Compare tissue-specific expression patterns across species using equivalent developmental stages

  • Analyze promoter regions to identify conserved and divergent regulatory elements

  • Compare stress-responsiveness across species under standardized metal exposure conditions

When conducting cross-species comparisons, consider the phylogenetic distance between monocots (like rice) and dicots (like Arabidopsis). Research has shown fundamental differences in HMP gene structure, expression patterns, and heavy metal stress responses between these plant groups . For example, while most selected OsHMPs showed differential expression under heavy metal stress, most AtHMPs maintained relatively constant expression levels under various stress conditions, suggesting divergent regulatory mechanisms .

What are the major challenges in studying transmembrane proteins like MTP4 and how can they be addressed?

Transmembrane proteins like MTP4 present unique experimental challenges due to their hydrophobic nature and membrane integration. The following methodological approaches can help overcome these common challenges:

Challenge 1: Protein solubility and purification

  • Solution: Optimize expression systems specifically designed for membrane proteins (e.g., E. coli strains optimized for membrane proteins)

  • Approach: Utilize the established in vitro E. coli expression system with N-terminal 10xHis-tagging for efficient purification

  • Consideration: Detergent screening to identify optimal solubilization conditions while maintaining native conformation

Challenge 2: Maintaining structural integrity during experiments

  • Solution: Validate protein folding using circular dichroism or limited proteolysis

  • Approach: Store protein at -20°C/-80°C to preserve structure, with working aliquots at 4°C for up to one week

  • Consideration: Reconstitution in membrane mimetics (nanodiscs, liposomes) for functional studies

Challenge 3: Correlating in vitro findings with in vivo function

  • Solution: Complement biochemical studies with genetic approaches in planta

  • Approach: Develop transgenic rice lines with modified MTP4 expression

  • Consideration: Use fluorescently-tagged MTP4 to track subcellular localization in living plant cells

Challenge 4: Distinguishing MTP4 functions from other MTPs

  • Solution: Design experiments that isolate MTP4-specific effects

  • Approach: Employ gene-specific knockout/knockdown strategies

  • Consideration: Account for potential functional redundancy in experimental design

By addressing these challenges with appropriate methodological solutions, researchers can generate more reliable and physiologically relevant data on MTP4 function and regulation.

How should researchers interpret contradictory results in MTP4 expression studies?

Contradictory results in MTP4 expression studies are common due to variations in experimental conditions, genetic backgrounds, and analytical methods. Adopt the following systematic approach to reconcile conflicting findings:

Source identification:

  • Methodological differences: Compare sample preparation, RNA extraction methods, and quantification techniques

  • Experimental conditions: Evaluate differences in growth conditions, metal concentrations, and exposure duration

  • Genetic factors: Consider varietal differences in rice cultivars that may affect baseline expression or induction

Reconciliation strategies:

  • Meta-analysis approach: Systematically compare multiple studies to identify consistent patterns and outliers

  • Standardization experiments: Perform side-by-side comparisons under identical conditions

  • Multi-level validation: Confirm expression changes using complementary techniques (e.g., qRT-PCR, RNA-Seq, protein levels)

Contextual interpretation:

  • Tissue-specific considerations: Heavy metal stress responses often vary significantly between tissues

  • Temporal dynamics: Expression patterns may differ dramatically between early and late responses

  • Metal specificity: Different metals may induce distinct expression patterns for the same gene

When analyzing MTP4 expression, consider that research has shown substantial variation in expression of HMPs in response to different heavy metals. While some genes like OsHMP09, OsHMP18, and OsHMP22 showed consistent upregulation across tissues under various metal stresses, other HMPs displayed more variable responses . This heterogeneity likely reflects the complex and multifaceted nature of plant metal stress responses.

What controls and validations are essential when studying MTP4 function in transgenic plants?

Essential controls:

  • Wild-type comparisons: Include non-transformed plants from the same genetic background

  • Empty vector controls: Transform plants with the same vector lacking the MTP4 insert

  • Expression-matched lines: Select transgenic lines with comparable expression levels for fair comparisons

  • Recovery controls: Include metal-free recovery periods to distinguish tolerance from avoidance

Critical validations:

  • Insertion verification: Confirm transgene insertion using genomic PCR

  • Expression validation: Quantify MTP4 transcript levels using qRT-PCR

  • Protein validation: Verify protein expression using Western blotting

  • Localization confirmation: Determine subcellular localization matches expected patterns

  • Phenotypic stability: Confirm consistent phenotypes across multiple generations and independent transformation events

Experimental design considerations:

  • Dosage studies: Test multiple metal concentrations to establish dose-response relationships

  • Combined stresses: Evaluate MTP4 function under combined stress conditions (e.g., metal stress plus drought)

  • Field validation: Complement controlled environment studies with field trials where possible

What emerging technologies could advance our understanding of MTP4 function and regulation?

Emerging technologies are creating new opportunities to investigate MTP4 with unprecedented precision and breadth. Researchers should consider integrating these advanced approaches into their experimental designs:

Structural biology advances:

  • Cryo-electron microscopy: Determine high-resolution structures of MTP4 in different conformational states

  • AlphaFold and similar AI tools: Generate accurate structural predictions to guide experimental design

  • Single-molecule FRET: Analyze real-time conformational changes during metal binding and transport

Genetic engineering technologies:

  • CRISPR-Cas9 base editing: Create precise mutations to study structure-function relationships without introducing exogenous DNA

  • Optogenetics: Develop light-controlled MTP4 variants to manipulate activity with temporal precision

  • Tissue-specific inducible systems: Control MTP4 expression with spatial and temporal specificity

Advanced imaging techniques:

  • Super-resolution microscopy: Visualize MTP4 distribution at nanoscale resolution

  • Correlative light and electron microscopy: Connect functional imaging with ultrastructural context

  • Live-cell metal sensors: Monitor metal flux in real-time in relation to MTP4 activity

Multi-omics integration:

  • Single-cell transcriptomics: Map MTP4 expression at cellular resolution across tissues

  • Spatially resolved proteomics: Determine MTP4 protein levels with spatial context

  • Metabolomics: Connect MTP4 function to downstream metabolic changes

These technologies can be applied within the established experimental design framework, ensuring careful definition of variables, appropriate controls, and rigorous statistical analysis . The integration of multiple approaches will provide a more comprehensive understanding of MTP4 biology than any single method alone.

How might MTP4 research contribute to improving heavy metal tolerance in crops?

Research on MTP4 has significant translational potential for developing crops with enhanced heavy metal tolerance. A systematic research pipeline could include:

Fundamental knowledge establishment:

  • Comprehensive characterization: Fully define MTP4's metal specificity, transport kinetics, and regulatory mechanisms

  • Structure-function analysis: Identify specific domains that could be modified to enhance metal tolerance

  • Regulatory network mapping: Determine how MTP4 expression is controlled under various stress conditions

Applied breeding approaches:

  • Natural variation screening: Identify rice varieties with enhanced MTP4 expression or activity

  • Marker-assisted selection: Develop molecular markers associated with optimal MTP4 alleles

  • Targeted genetic modification: Create rice variants with optimized MTP4 expression patterns

Validation and implementation:

  • Field testing: Evaluate enhanced lines under realistic agricultural conditions

  • Metal uptake profiling: Ensure metal sequestration doesn't lead to food safety concerns

  • Environmental impact assessment: Determine effects on soil ecology and sustainability

The translational pathway should build upon the established understanding that plants have evolved sophisticated mechanisms for heavy metal tolerance, with MTP4 representing one component of a complex stress response system . By enhancing this natural system through targeted modifications, researchers can potentially develop rice varieties with improved growth and yield in metal-contaminated soils without compromising food safety or environmental sustainability.

What interdisciplinary approaches could enhance MTP4 research productivity?

Interdisciplinary collaboration offers powerful opportunities to accelerate MTP4 research beyond what could be achieved within single disciplines. Consider the following integrative approaches:

Computational-experimental integration:

  • Molecular dynamics simulations: Model MTP4-metal interactions to guide experimental design

  • Machine learning analysis: Identify patterns in expression data across diverse experiments

  • Systems biology modeling: Place MTP4 within broader metal homeostasis networks

Plant science-soil science collaboration:

  • Rhizosphere studies: Investigate how root exudates influence metal availability to MTP4-expressing cells

  • Soil microbiome interactions: Explore how microbial communities affect plant metal uptake and MTP4 regulation

  • Biogeochemical cycling: Connect plant MTP4 function to larger environmental metal cycles

Molecular biology-crop science synergy:

  • Translating mechanistic insights: Move from model systems to agriculturally relevant varieties

  • Field-to-lab-to-field pipeline: Validate laboratory findings under realistic growing conditions

  • Participatory research: Engage farmers in identifying target environments for enhanced varieties

Environmental science-plant molecular biology integration:

  • Phytoremediation applications: Explore MTP4 modifications for environmental cleanup

  • Climate change interaction studies: Investigate how altered climate conditions affect MTP4 function

  • Ecosystem-level consequences: Assess broader impacts of modified metal tolerance traits

These interdisciplinary approaches can be structured within the framework of sound experimental design principles, ensuring that even complex, multi-faceted studies maintain clear variable definitions, appropriate controls, and rigorous analysis methodologies . By bridging disciplinary boundaries, researchers can address more complex questions about MTP4 biology and applications than would be possible within traditional disciplinary silos.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.