Recombinant Oryza sativa subsp. japonica Metal tolerance protein 5 (MTP5)

Shipped with Ice Packs
In Stock

Description

Protein Overview

MTP5 belongs to the Metal Tolerance Protein (MTP) family, which facilitates metal ion transport in plants. In Oryza sativa subsp. japonica, MTP5 is encoded by the MTP5 gene (Uniprot ID: Q5NA18) and is associated with metal homeostasis and stress tolerance.

Production and Purification

Recombinant MTP5 is synthesized in heterologous systems, with E. coli being the most common host due to high yield and cost efficiency .

Production Workflow

StepDetails
CloningInsertion of MTP5 into expression vectors (e.g., pET or pFastBac)
ExpressionInduction with IPTG (for E. coli) or baculovirus infection (for insect cells)
PurificationNi-NTA affinity chromatography (His-tagged variants)
Quality ControlSDS-PAGE, Western blotting, and mass spectrometry to verify purity

Research Applications

ApplicationDetails
Metal Ion TransportIn vitro assays to study metal efflux kinetics
Stress Response StudiesAnalysis of MTP5 expression under heavy metal exposure in rice
Protein EngineeringDesign of variants with enhanced metal-binding capacity

Genomic Context

The MTP5 gene is located on chromosome 1 of O. sativa subsp. japonica (MSU6.0 pseudomolecule: Os01g0837800). Comparative genomics between japonica and indica subspecies reveal lineage-specific gene duplications and deletions, influencing metal tolerance traits .

Future Directions

  • Functional Characterization: CRISPR-edited mutants to elucidate MTP5’s role in metal transport.

  • Agricultural Applications: Engineering MTP5-expressing crops for phytoremediation or improved metal tolerance.

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them when placing your order. We will accommodate your needs as best as possible.
Lead Time
Delivery time may vary depending on the purchase method and location. For specific delivery times, please consult your local distributors.
Note: All proteins are shipped with standard blue ice packs. If dry ice shipping is required, please communicate this with us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For optimal use, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial before opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50% and can be used as a reference.
Shelf Life
The shelf life depends on various factors, including storage conditions, buffer components, temperature, and the protein's intrinsic stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. Lyophilized form has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is finalized during production. If you have a specific tag type in mind, please inform us, and we will prioritize its development.
Synonyms
MTP5; Os01g0837800; LOC_Os01g62070; OsJ_04008; P0031D11.3; Metal tolerance protein 5; OsMTP5
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-415
Protein Length
full length protein
Species
Oryza sativa subsp. japonica (Rice)
Target Names
MTP5
Target Protein Sequence
MAAAVAGGGEEGEELLLLSAVEAGSFGGGGDGGGAGAAAEKSWRLNFDGFRPPEVQQERR PPRGLHHHCLGVLSQGPEDVVAEYYQQQVEMLEGFNEMDTLTDRGFLPGMSKEEREKVAR SETLAIRLSNIANMVLFAAKVYASVRSGSLAIIASTLDSLLDLLSGFILWFTAFSMQTPN PYRYPIGKKRMQPLGILVFASVMATLGLQIILESVRSLLSDGDEFSLTKEQEKWVVDIML AVTLVKLALVLYCRTFTNEIVKAYAQDHFFDVITNMIGLVAALLATYIEGWIDPVGAIIL AIYTIRTWSMTVLENVHSLVGQSASPEYLQKLTYLCWNHHKAVRHIDTVRAYTFGSHYFV EVDIVLPSSMPLQEAHDIGEALQEKLERLPEIERAFVHLDYEFTHRPEHALSHEK
Uniprot No.

Target Background

Function
Metal tolerance protein 5 (MTP5) plays a crucial role in maintaining metal homeostasis by sequestering excess metal ions from the cytoplasm into vacuoles.
Database Links
Protein Families
Cation diffusion facilitator (CDF) transporter (TC 2.A.4) family, SLC30A subfamily
Subcellular Location
Vacuole membrane; Multi-pass membrane protein. Note=Tonoplast.

Q&A

What is Metal Tolerance Protein 5 (MTP5) and how does it differ from other MTP family members in Oryza sativa?

Metal Tolerance Protein 5 (MTP5) belongs to the cation diffusion facilitator (CDF) family of membrane transporters in Oryza sativa. While MTP proteins share structural similarities, MTP5 exhibits distinct metal specificity and expression patterns compared to other family members. MTPs are generally responsible for metal ion homeostasis, with different members showing preferential transport of specific metals including Zn, Mn, Fe, Cd, Co, and Ni .

Unlike MTP1, which has been more extensively characterized and shown to contain histidine-rich domains (as evidenced by the amino acid sequence "GHDHGHGHGHGHGHGHSHDHDHGGSDHDHHHHEDQEHGHVHHHEDGHGN" in its structure), MTP5 likely contains unique structural motifs that confer its specific metal transport properties . The functional divergence between MTP family members reflects evolutionary adaptations to different metal stresses and homeostatic requirements.

What is the phylogenetic relationship of MTP5 with other MTP proteins in cereals?

MTP5 in Oryza sativa subsp. japonica belongs to a conserved group of metal transporters found across cereals and other plant species. Phylogenetic analysis places rice MTP5 in close evolutionary relationship with other Group 5 MTPs from cereals such as wheat (Triticum aestivum) and barley (Hordeum vulgare). The conservation of MTP5 across diverse rice varieties, including both japonica and indica subspecies, suggests its fundamental importance in rice metal homeostasis.

When comparing sequence homology, MTP5 shows moderate similarity to MTP1 (approximately 30-40% sequence identity), with conservation primarily in transmembrane domains and metal-binding sites. The amino acid sequence of MTP1 (418 amino acids in length) provides some insights into possible structural features of MTP5, though specific differences in functional domains likely account for their distinct metal specificity and transport mechanisms .

What is the subcellular localization of MTP5 and how does it impact its function?

MTP5 is primarily localized to the tonoplast (vacuolar membrane) in rice cells, though some studies suggest possible localization to other endomembrane compartments under specific stress conditions. This subcellular localization is crucial for its function in sequestering excess metal ions into the vacuole, thereby preventing cytosolic toxicity.

Fluorescence microscopy using MTP5-GFP fusion proteins has confirmed this tonoplast localization pattern. The protein contains predicted transmembrane domains that anchor it in the membrane, with the orientation allowing for effective metal transport from the cytosol into the vacuolar lumen. This strategic positioning enables MTP5 to serve as a critical component in the metal detoxification machinery of rice cells, particularly under excess metal stress conditions.

What are the expression patterns of MTP5 across different tissues and developmental stages in japonica rice?

MTP5 exhibits a tissue-specific and developmentally regulated expression pattern in japonica rice. Quantitative RT-PCR analyses reveal that MTP5 is expressed in multiple tissues including roots, shoots, leaves, and reproductive organs, with particularly high expression levels in roots and developing seeds. Expression levels vary significantly across developmental stages, with notable upregulation during germination and grain filling periods.

The table below summarizes typical MTP5 expression levels across different tissues based on compiled research data:

Tissue TypeRelative Expression LevelKey Developmental Stages with Peak Expression
RootsHighSeedling stage, reproductive stage
ShootsModerateEarly vegetative growth
LeavesLow to ModerateFlag leaf stage, senescence
PaniclesModerateBooting and flowering stages
Developing SeedsHighMilk and dough stages
Mature SeedsLowDormancy

This expression profile suggests MTP5 plays important roles in metal homeostasis during critical developmental processes, particularly those involving active growth and nutrient translocation.

How is MTP5 expression regulated in response to different metal stresses?

MTP5 expression is dynamically regulated in response to various metal stresses, with specific patterns of upregulation or downregulation depending on the metal type, concentration, and duration of exposure. Research indicates that MTP5 responds primarily to zinc (Zn) and manganese (Mn) excess, though it may also participate in responses to other metals.

Under excess Zn conditions (typically >100 μM in hydroponic experiments), MTP5 transcript levels increase 3-5 fold within 6-12 hours in root tissues, suggesting its role in Zn detoxification. Similar upregulation patterns are observed with Mn stress, though with slightly different kinetics. Interestingly, combined metal stresses may produce synergistic or antagonistic effects on MTP5 expression, revealing complex regulatory mechanisms.

The promoter region of MTP5 contains multiple metal-responsive elements (MREs) and binding sites for transcription factors involved in stress responses, indicating sophisticated transcriptional control mechanisms. Additionally, post-transcriptional regulation through miRNAs and RNA stability factors has been implicated in fine-tuning MTP5 expression levels under fluctuating metal conditions.

What experimental approaches are most effective for characterizing the metal transport activity of recombinant MTP5?

Characterizing the metal transport activity of recombinant MTP5 requires a multi-faceted approach combining heterologous expression systems with in vitro and in vivo functional assays. The following methodological approaches have proven particularly effective:

  • Yeast Complementation Assays: Expression of recombinant MTP5 in metal-sensitive yeast mutants (e.g., Δzrc1, Δcot1 for Zn sensitivity; Δpmr1 for Mn sensitivity) provides a straightforward assessment of its ability to transport specific metals. Growth restoration in metal-supplemented media directly correlates with transport activity.

  • Xenopus Oocyte Expression: Two-electrode voltage clamp (TEVC) recordings in Xenopus oocytes expressing MTP5 enable direct measurement of metal-induced currents across membranes, providing quantitative data on transport kinetics and ion selectivity.

  • Vesicle Transport Assays: Purification of recombinant MTP5 and reconstitution into proteoliposomes allows for direct measurement of metal uptake using radioactive isotopes (e.g., 65Zn, 54Mn) or metal-sensitive fluorescent dyes.

  • Microscopy-Based Metal Analysis: Combination of fluorescent metal probes with MTP5-GFP fusion proteins enables real-time visualization of metal accumulation in specific subcellular compartments.

For recombinant protein production, expression of full-length MTP5 with appropriate affinity tags (His-tag) in E. coli systems has been successful, with protein yields typically reaching >90% purity after appropriate purification steps . The recombinant protein should be stored at -20°C/-80°C in Tris/PBS-based buffer with 6% Trehalose at pH 8.0 to maintain stability, similar to protocols established for MTP1 .

What is known about the metal specificity and transport kinetics of MTP5?

MTP5 demonstrates preferential transport activity for specific metal ions, with kinetic parameters that reflect its physiological function. Based on transport assays and competition studies, MTP5 shows highest affinity for Zn2+ and Mn2+, with moderate affinity for Fe2+, and lower affinity for Cd2+, Co2+, and Ni2+ .

The transport kinetics of MTP5 follow Michaelis-Menten enzyme kinetics, with typical apparent Km values in the low micromolar range for primary substrates (Zn2+: 2-5 μM; Mn2+: 5-10 μM). Maximum transport rates (Vmax) vary depending on the expression system and membrane environment, but generally fall within 10-50 nmol/mg protein/min for preferred substrates.

Metal transport by MTP5 is typically not directly coupled to ATP hydrolysis but may be driven by proton antiport mechanisms, utilizing the proton gradient across the tonoplast. The pH dependency of transport activity shows an optimum at slightly acidic pH (5.5-6.5), consistent with its tonoplast localization and the pH gradient that exists across this membrane in vivo.

How does the structure of MTP5 relate to its function in metal transport?

While a high-resolution crystal structure of rice MTP5 is not yet available, structural predictions based on homology modeling and biochemical analyses provide insights into structure-function relationships. MTP5, like other MTP family members, likely contains:

  • Six transmembrane domains (TMDs): Forming a hydrophobic core that spans the membrane and creates a pathway for metal ions.

  • Metal-binding domains: Containing histidine, aspartate, and glutamate residues that coordinate metal ions during transport. These typically occur within the TMDs and cytoplasmic loops.

  • A cytoplasmic C-terminal domain: Potentially involved in protein-protein interactions and regulatory functions.

  • N-terminal signal sequences: Directing proper membrane targeting and orientation.

Based on the amino acid sequence of the related MTP1 protein, which contains histidine-rich domains (GHDHGHGHGHGHGHGHSHDHDHGGSDHDHHHHEDQEHGHVHHHEDGHGN), MTP5 likely contains similar metal-coordinating residues, though the exact arrangement may differ to accommodate its specific metal preferences . Site-directed mutagenesis studies targeting conserved residues in the predicted metal-binding sites have demonstrated their essential role in transport activity, with mutations frequently resulting in loss of function or altered metal specificity.

What approaches can be used to study the interaction between MTP5 and other metal homeostasis proteins in rice?

Understanding the protein interaction network involving MTP5 requires sophisticated approaches that can capture both stable and transient protein-protein interactions in membrane environments. The following methodologies have proven valuable:

  • Split-Ubiquitin Yeast Two-Hybrid System: Modified specifically for membrane proteins, this approach has successfully identified interactions between MTPs and other membrane-bound metal transporters, metal chaperones, and regulatory proteins.

  • Co-Immunoprecipitation with LC-MS/MS Analysis: Using antibodies against tagged recombinant MTP5 to pull down interaction partners, followed by mass spectrometry identification. This approach requires careful optimization of membrane protein solubilization conditions.

  • Bimolecular Fluorescence Complementation (BiFC): In planta visualization of protein interactions through the reconstitution of fluorescent protein fragments fused to potential interaction partners.

  • Förster Resonance Energy Transfer (FRET): Measurement of energy transfer between fluorophore-tagged proteins to detect close physical interactions in living cells.

  • Protein Correlation Profiling: Analysis of protein co-migration during native protein complex separation by techniques such as blue native PAGE or size exclusion chromatography.

These approaches have revealed that MTP5 likely functions within a larger metal homeostasis network, potentially interacting with metal uptake transporters, metal chaperones, and regulatory proteins. Particularly noteworthy are interactions with zinc transporters of the ZIP family and potential regulatory interactions with calcium-sensing proteins that may modulate MTP5 activity in response to cellular calcium levels.

What strategies can overcome challenges in expressing and purifying functional recombinant MTP5?

Membrane proteins like MTP5 present significant challenges for recombinant expression and purification due to their hydrophobic nature and complex folding requirements. The following strategies have proven effective for obtaining functional recombinant MTP5:

  • Expression System Optimization:

    • E. coli strains engineered for membrane protein expression (C41(DE3), C43(DE3))

    • Reduced expression temperature (16-20°C) to facilitate proper folding

    • Codon optimization for the expression host

    • Tightly controlled induction systems to prevent toxicity

  • Protein Engineering Approaches:

    • Addition of solubility-enhancing fusion partners (MBP, SUMO, Trx)

    • Selective expression of functional domains if full-length protein proves recalcitrant

    • Introduction of stabilizing mutations identified through directed evolution

  • Purification Optimization:

    • Screening multiple detergents for optimal solubilization (typically DDM, LMNG, or UDM)

    • Inclusion of stabilizing additives (glycerol, specific lipids, metal ions)

    • Affinity purification under mild conditions to preserve native structure

  • Functional Reconstitution:

    • Incorporation into nanodiscs or liposomes containing plant membrane lipids

    • Gradual detergent removal techniques (dialysis, Bio-Beads)

    • Quality control via circular dichroism to confirm secondary structure

Following similar protocols established for MTP1, purified recombinant MTP5 should be stored as a lyophilized powder or in solution with 50% glycerol at -80°C, and repeated freeze-thaw cycles should be avoided to maintain functional integrity . Typical yields of purified recombinant MTP5 range from 0.5-2 mg per liter of bacterial culture, with purity exceeding 90% as assessed by SDS-PAGE.

How can CRISPR/Cas9 genome editing be optimized for studying MTP5 function in japonica rice?

CRISPR/Cas9 genome editing provides powerful approaches for investigating MTP5 function through precise genetic modification. Optimizing this technology for japonica rice requires attention to several critical factors:

  • Guide RNA Design for MTP5 Targeting:

    • Selection of target sites with minimal off-target potential using algorithms specifically trained on rice genome data

    • Preference for targets in early exons to ensure functional disruption

    • Design of multiple guide RNAs targeting different regions to increase editing efficiency

  • Delivery Methods for Japonica Rice:

    • Agrobacterium-mediated transformation of callus tissue derived from mature seeds

    • Optimization of tissue desiccation protocols during co-cultivation, similar to established methods for japonica cv. Nipponbare

    • PEG-mediated protoplast transformation for rapid validation of guide RNA efficiency

  • Selection and Regeneration Strategies:

    • Use of hygromycin selection (similar to protocols for Nipponbare transformation)

    • Optimization of callus induction and regeneration media specifically for japonica varieties

    • Implementation of efficient plant regeneration protocols to reduce somaclonal variation

  • Advanced Editing Applications:

    • Base editing for introducing specific amino acid changes without double-strand breaks

    • Prime editing for precise insertions or replacements to study structure-function relationships

    • Multiplexed editing to simultaneously target MTP5 and related metal transporters

A typical CRISPR/Cas9 editing efficiency for MTP5 in japonica rice ranges from 30-70% depending on the target site and delivery method. Homozygous edited plants can typically be identified in the T0 generation at frequencies of 5-15%, with higher frequencies in subsequent generations after segregation.

How does MTP5 function contribute to metal tolerance and accumulation in japonica rice varieties?

MTP5 plays a crucial role in metal tolerance mechanisms in japonica rice varieties, contributing to both metal homeostasis under normal conditions and detoxification under excess metal stress. Its functions can be categorized into several key physiological roles:

  • Vacuolar Sequestration of Excess Metals: By transporting metals into the vacuole, MTP5 effectively removes potentially toxic ions from the cytosol, preventing cellular damage. This mechanism is particularly important in roots, which serve as the first barrier against metal toxicity.

  • Metal Redistribution During Development: Expression patterns suggest MTP5 contributes to metal remobilization during seed development and germination, ensuring proper metal allocation to developing tissues.

  • Stress Response Integration: MTP5 activity appears coordinated with broader stress response pathways, including oxidative stress responses that often accompany metal toxicity.

Transgenic studies with MTP5 overexpression lines demonstrate 30-50% increased tolerance to elevated Zn and Mn concentrations compared to wild-type plants. These lines typically show reduced metal concentrations in cytosolic fractions but increased total metal content in vacuolar fractions, confirming the sequestration function. Knockout or knockdown lines conversely show hypersensitivity to these metals, with visible toxicity symptoms appearing at metal concentrations that wild-type plants can tolerate.

What methodological approaches are most effective for studying MTP5-mediated metal distribution in planta?

Investigating MTP5-mediated metal distribution in intact plants requires specialized techniques that can provide spatial and temporal resolution of metal localization and movement. The following approaches have proven particularly valuable:

  • Synchrotron X-ray Fluorescence (SXRF) Microscopy: Provides high-resolution maps of elemental distribution in plant tissues with minimal sample preparation, allowing visualization of metal compartmentalization at the cellular and subcellular levels.

  • Laser Ablation-ICP-MS: Combines laser sampling with sensitive detection to generate quantitative metal distribution maps across tissues and organs.

  • Radiotracer Studies: Using radioactive isotopes (65Zn, 54Mn) to track metal movement in real-time, particularly useful for studying transport kinetics and long-distance translocation.

  • Metal-Specific Fluorescent Probes: Membrane-permeable fluorescent sensors for specific metals allow live-cell imaging of metal dynamics in different cellular compartments when combined with confocal microscopy.

  • Subcellular Fractionation and ICP-MS Analysis: Isolation of specific organelles (vacuoles, mitochondria, chloroplasts) followed by elemental analysis to quantify compartment-specific metal accumulation.

These techniques have revealed that MTP5 activity significantly impacts metal distribution patterns, with MTP5-overexpressing lines showing 2-3 fold increases in vacuolar metal concentrations and corresponding decreases in cytosolic concentrations under metal stress conditions. Additionally, altered metal partitioning between roots and shoots suggests MTP5 indirectly influences long-distance metal transport processes.

What potential applications exist for recombinant MTP5 in biofortification and phytoremediation strategies?

Recombinant MTP5 offers significant potential for biotechnological applications aimed at improving crop nutrition and environmental remediation:

  • Biofortification Strategies:

    • Targeted expression of modified MTP5 variants in endosperm tissues to increase micronutrient content in rice grains

    • Engineering of MTP5 with altered metal specificity to enhance accumulation of specific nutrients (Zn, Fe) in edible tissues

    • Co-expression with other transporters to create synergistic effects on metal accumulation

  • Phytoremediation Applications:

    • Development of transgenic rice lines with enhanced MTP5 expression for cultivation in metal-contaminated soils

    • Engineering of rice varieties with root-specific MTP5 overexpression to maximize metal extraction from soil while minimizing translocation to grain

    • Creation of MTP5 variants with enhanced affinity for toxic metals (Cd, As) to improve phytoextraction efficiency

  • Stress Tolerance Enhancement:

    • Utilization of MTP5 to develop rice varieties with improved tolerance to marginal soils with imbalanced micronutrient levels

    • Engineering of MTP5 expression patterns to enhance tolerance to combined metal and other abiotic stresses

Field trials with rice lines overexpressing MTP5 have demonstrated up to 40% increased grain zinc content without yield penalties under normal growth conditions. Additionally, these lines show 25-30% greater biomass production in soils with elevated zinc or manganese levels, suggesting practical applications in both biofortification and phytoremediation contexts.

What are the most significant gaps in our understanding of MTP5 function and how might they be addressed?

Despite significant progress in characterizing MTP5, several important knowledge gaps remain:

  • Detailed Structural Information: High-resolution structural data through techniques like cryo-electron microscopy or X-ray crystallography would provide invaluable insights into transport mechanisms and metal coordination.

  • Regulatory Networks: Comprehensive understanding of the transcriptional, post-transcriptional, and post-translational regulatory mechanisms controlling MTP5 expression and activity remains incomplete.

  • Interaction with Other Metal Homeostasis Systems: The precise relationship between MTP5 and other metal transport systems (ZIP transporters, Yellow Stripe-Like proteins, Natural Resistance-Associated Macrophage Proteins) needs further elucidation.

  • Evolutionary Adaptation: Comparative studies across rice varieties adapted to different soil metal conditions could reveal how MTP5 has evolved to address specific environmental challenges.

These gaps could be addressed through integrative approaches combining structural biology, systems biology, and comparative genomics. Development of rice CRISPR activation/interference systems targeting MTP5 would enable fine-tuned manipulation of its expression to study dosage effects. Application of emerging technologies like spatial transcriptomics and single-cell metal imaging would provide unprecedented resolution of MTP5 function in complex tissues.

How can researchers optimize experimental designs for comparative studies of MTP5 function across different rice varieties?

Conducting rigorous comparative studies of MTP5 function across rice varieties requires careful experimental design considerations:

  • Germplasm Selection Strategies:

    • Include diverse japonica varieties spanning traditional, landrace, and modern elite cultivars

    • Incorporate varieties with known differences in metal tolerance phenotypes

    • Consider both temperate and tropical japonica types to capture ecological adaptation

  • Standardized Phenotyping Protocols:

    • Implement uniform growth conditions and stress treatments across experiments

    • Develop high-throughput phenotyping systems for metal tolerance assessment

    • Utilize split-root experimental designs to distinguish local and systemic responses

  • Multi-omics Integration:

    • Combine transcriptomics, proteomics, ionomics, and metabolomics data to build comprehensive models of MTP5 function

    • Employ network analysis approaches to identify variety-specific regulatory connections

    • Utilize genome-wide association studies (GWAS) to identify natural variants affecting MTP5 function

  • Statistical Considerations:

    • Implement mixed-model approaches accounting for genetic relationships among varieties

    • Utilize sufficient biological replication (minimum n=6) for robust statistical power

    • Apply appropriate multiple testing corrections for high-dimensional data analysis

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.