Located on chromosome 5 in rice.
Exon-intron structure typical of rice genes: ~5 exons per transcript, with UTRs spanning ~23–72 Mb in the genome .
Evolutionary analysis suggests conservation of functional domains across monocots and dicots, with lineage-specific duplications .
Phylogenetic Tree: MTP6 clusters with other rice MTPs, showing divergence from Arabidopsis thaliana orthologs .
SNP Diversity: High Tajima’s D values (0.3–4.8) indicate balancing selection, preserving functional alleles in rice populations .
Protein Conservation: MTP6 exhibits high sequence conservation across rice genotypes, with rare non-synonymous SNPs (<5% allele frequency) .
Metal Transport: Facilitates vacuolar sequestration of metals (Zn, Mn, Fe, Cd, Co, Ni) to mitigate toxicity .
Co-localization with QTLs: Overlaps with quantitative trait loci (QTLs) linked to metal tolerance, though specific associations require further validation .
Amino Acid Sequence:
MAAAAGVAAGTGRGSGEGEELLPNAVEGDGGCGGGGTCAGDRPWRLNFDGLRRPEAHQEK...
(Full sequence available in )
Structural Discrepancies: Initial TMHMM predictions failed to detect transmembrane domains, necessitating 3D modeling for accurate topology .
Functional Gaps: Direct evidence for MTP6’s role in specific metal transport pathways remains limited.
Research Applications: Recombinant MTP6 is used in in vitro assays to study metal-binding kinetics and membrane integration .
| Motif | Description |
|---|---|
| Motif 1 | Conserved across MTP family; ligand-binding |
| Motif 2 | Phosphorylation site (TYR residues) |
| Motif 3 | Cytoskeleton interaction domain |
KEGG: osa:4339024
Recombinant OsMTP6 can be expressed using several different expression systems:
E. coli Expression System:
The full-length coding sequence (1-376aa) can be cloned into an expression vector with an N-terminal His-tag .
After transformation into E. coli, expression is induced following standard protocols.
The protein is purified as a lyophilized powder with >90% purity as determined by SDS-PAGE .
Storage and Handling:
Store at -20°C/-80°C upon receipt
Aliquoting is necessary for multiple use
Avoid repeated freeze-thaw cycles
Reconstitute in deionized sterile water to 0.1-1.0 mg/mL
Add 5-50% glycerol (final concentration) and aliquot for long-term storage
Alternative expression systems include yeast, baculovirus, and mammalian cell expression systems, which may offer advantages for proper folding and post-translational modifications .
The metal transport function of MTP6 has been experimentally demonstrated through several approaches:
Heterologous Expression in Yeast:
Expression of MTP6 homologs (e.g., CsMTP6 from cucumber) in yeast cells led to increased Mn accumulation and restored growth of mutants hypersensitive to Mn .
CsMTP6 expression in wild-type yeast resulted in a cobalt-resistant phenotype and suppressed the Co-sensitive phenotype in Δmmt1Δmmt2 cells .
Mitochondrial Metal Content Analysis:
Subcellular Localization Studies:
While the search results don't provide specific information about OsMTP6 regulation, studies on CsMTP6 (cucumber homolog) provide insights:
Root expression and protein levels of CsMTP6 were significantly up-regulated under both Fe deficiency and excess conditions .
MTP6 expression was not affected by Mn availability, suggesting specific regulation by Fe but not Mn .
The regulation of MTP6 appears to be connected to iron homeostasis mechanisms, with expression changes occurring to maintain proper iron distribution between cellular compartments, particularly under conditions of suboptimal or excessive iron availability.
MTP6 plays a crucial role in the intricate network of metal homeostasis in rice through several mechanisms:
Rice japonica varieties demonstrate significantly higher metal tolerance than indica and aus varieties, with about 57% of phenotypic variation in aluminum tolerance correlated with subpopulation, suggesting specialized adaptations in different rice subspecies .
Site-directed mutagenesis represents a powerful approach to understanding the structure-function relationship of MTP6:
Key Residues for Targeted Mutagenesis:
Based on studies with related MTPs, mutations in histidine residues within the CDF signature sequence are critical. For example:
Experimental Design for Mutagenesis Studies:
Clone the full-length OsMTP6 cDNA into an expression vector
Introduce point mutations using PCR-based site-directed mutagenesis
Express wild-type and mutant proteins in metal-sensitive yeast strains
Assess yeast growth under varying metal concentrations
Measure metal accumulation in transformed yeast cells and isolated mitochondria
Residues of Interest Based on Related Proteins:
A methodical mutational analysis focusing on conserved residues would help identify the critical amino acids determining metal selectivity and transport efficiency of OsMTP6.
Several complementary approaches can be employed to investigate MTP6 function in vivo:
CRISPR-Cas9 Gene Editing:
Generate MTP6 knockout or knockdown rice plants
Design guide RNAs targeting exons of the MTP6 gene
Analyze metal content in different tissues and organelles of mutant plants
Examine plant performance under varying metal stress conditions
Overexpression Studies:
Subcellular Localization:
Create MTP6-GFP fusion constructs for in vivo localization
Use techniques like leaf cell protoplast transformation or particle bombardment
Confirm mitochondrial localization using co-localization with mitochondrial markers
Transcriptome Analysis:
Compare gene expression profiles between wild-type and MTP6 mutant plants under various metal stress conditions
Identify downstream genes and pathways affected by MTP6 disruption
Phenotypic Characterization Under Metal Stress:
Expose plants to varying levels of Fe, Mn, and other metals
Measure physiological parameters (photosynthesis, growth, yield)
Quantify metal content in different tissues using AAS or ICP-MS
Comparative analysis reveals important insights into the evolutionary and functional diversity of MTP6:
Comparison Between Rice Subspecies:
Japonica rice varieties demonstrate significantly higher metal tolerance than indica and aus varieties .
Approximately 57% of phenotypic variation in aluminum tolerance is correlated with subpopulation .
The genetic architecture of rice aluminum tolerance involves different genes and genomic regions associated with tolerance in different subpopulations .
Comparison with Other Plant Species:
Evolutionary Relationships:
Rice and Arabidopsis appear to have experienced independent genome-wide duplication events, yet they share similar sets of functional domains among protein sequences .
Natural selection may have played a role in the evolution of duplicated genes in both species .
The distribution of paralog clusters is similar between rice and Arabidopsis, suggesting common selective pressures on gene duplication .
A detailed phylogenetic analysis revealed that MTP proteins fall into three distinct subgroups: Zn-CDF, Fe/Zn-CDF, and Mn-CDF, with MTP6 proteins belonging to the Fe/Zn-CDF subgroup .
Understanding MTP6 function offers several promising approaches for crop improvement:
Development of Metal-Tolerant Rice Varieties:
Overexpression of MTP6 might improve rice tolerance to iron and manganese toxicity, which are common problems in waterlogged rice paddies.
QTL analysis and bi-parental mapping can identify favorable MTP6 alleles in tolerant varieties for marker-assisted breeding .
Recent field experiments with japonica rice cultivars (2018-2023) demonstrate the importance of optimizing growing conditions for these varieties, with findings showing that total grain yield in control conditions averaged 8.5 t per hectare .
Biotechnological Applications:
Engineering MTP6 expression levels or activity could enhance iron use efficiency.
Creating rice varieties with improved adaptation to soils with varying metal content.
Potentially utilizing MTP6 in phytoremediation applications for metal-contaminated soils.
Adaptation to Climate Change:
Recent research (2025) on japonica rice cultivars under agrivoltaic systems shows their adaptability to reduced light conditions, with grain yields of 6.5 t per hectare compared to 8.5 t per hectare in control conditions .
Understanding metal homeostasis mechanisms is crucial as changing environmental conditions may alter metal availability in soils.
Integration with Other Metal Tolerance Mechanisms:
| Comparison of Metal Tolerance Across Rice Subpopulations |
|---|
| Varietal Group |
| Japonica |
| Indica |
| Admixed |
Table represents aluminum tolerance as measured by relative root growth (RRG) across different rice subpopulations
Based on available information for recombinant MTP6 and related proteins, the following protocol outlines optimal conditions:
Expression System Selection:
Expression Construct Design:
E. coli Expression Protocol:
Culture conditions: LB medium, 37°C for growth, induce at OD600 = 0.6-0.8
Induction: 0.1-1.0 mM IPTG, shift to lower temperature (16-25°C)
Harvest: 16-24 hours post-induction
Purification Strategy:
Storage for Maximum Stability:
Reconstitution for Activity Assays:
The purity should be greater than 90% as determined by SDS-PAGE , and functionality can be verified through metal transport assays in proteoliposomes or complementation of metal-sensitive yeast strains.
Multiple complementary approaches can be used to assess MTP6 metal transport activity:
In Vitro Methods:
Proteoliposome Metal Transport Assays:
Reconstitute purified MTP6 into liposomes
Incubate with radioactive metal isotopes (55Fe, 54Mn)
Measure metal uptake using filtration and scintillation counting
Compare transport rates with various metals to determine specificity
Membrane Vesicle Transport Assays:
Isolate membrane vesicles from cells expressing MTP6
Measure metal transport using fluorescent metal indicators or isotopes
Use ionophores and inhibitors to determine transport direction and mechanism
In Vivo Methods:
Yeast Functional Complementation:
Isolated Mitochondria Metal Measurements:
Plant Metal Distribution Analysis:
Generate transgenic plants with altered MTP6 expression
Separate cellular fractions (mitochondria, cytosol)
Quantify metals in each fraction
Use synchrotron X-ray fluorescence microscopy for in situ metal localization
For example, in studies with CsMTP6, mitochondria were isolated using a four-step sucrose gradient (60/32/23/15%), with intact mitochondria collected from the 60/32% interface .
Several cutting-edge genetic approaches are applicable for studying MTP6 function:
Genome-Wide Association Studies (GWAS):
Ancestral Recombination Graph (ARG) Analysis:
Construct ARGs encoded as tree sequences for both indica and japonica rice
Use branch-based relationship matrices (BRMs) for improved quantitative genetic analyses
Apply this approach to understand the evolution of MTP6 alleles across subspecies
This method has shown the highest predictive ability when combining both subspecies in genetic analyses
CRISPR-Cas Genome Editing:
InDel Marker Development:
Bi-Parental QTL Mapping:
Recent research has demonstrated the effectiveness of these approaches in rice, with GWAS studies identifying 97 loci associated with blast resistance, of which 82 were new regions .
Structural biology offers powerful insights into MTP6 function through these methodologies:
Homology Modeling:
Molecular Dynamics Simulations:
Simulate MTP6 in a lipid bilayer environment
Investigate conformational changes during the transport cycle
Model interactions with metal ions to understand selectivity
Predict effects of mutations on protein structure and function
Protein Crystallography:
Express and purify large quantities of recombinant MTP6
Screen for crystallization conditions
Determine high-resolution structure through X-ray crystallography
Co-crystallize with bound metals to identify binding sites
Cryo-Electron Microscopy:
Suitable for membrane proteins difficult to crystallize
Determine structure in a near-native environment
Capture different conformational states of the transport cycle
Site-Directed Spin Labeling and EPR Spectroscopy:
Introduce spin labels at specific residues
Measure distances between labeled sites to track conformational changes
Monitor protein dynamics during transport
The CDF signature sequence proposed by Paulsen and Saier (1997) and modified by Montanini et al. (2007) is highly conserved between species and important for metal transport and specificity . Structural studies focusing on this region would be particularly informative for understanding MTP6 function.