Recombinant Oryza sativa subsp. japonica Metal tolerance protein 6 (MTP6)

Shipped with Ice Packs
In Stock

Description

Gene and Protein Information

AttributeDetails
Gene NameMTP6 (LOC_Os05g38670, Os05g0461900)
Protein IDUniProt: Q0DHJ5
SpeciesOryza sativa subsp. japonica (Rice)
Protein Length376 amino acids (full-length)
Transmembrane Domains10–12 domains predicted via 3D homology modeling (contrary to initial TMHMM analysis)
Key MotifsEight conserved motifs identified (e.g., ligand-binding domains, phosphorylation sites)

Genomic Context:

  • Located on chromosome 5 in rice.

  • Exon-intron structure typical of rice genes: ~5 exons per transcript, with UTRs spanning ~23–72 Mb in the genome .

  • Evolutionary analysis suggests conservation of functional domains across monocots and dicots, with lineage-specific duplications .

Phylogenetic and Evolutionary Analysis

  • Phylogenetic Tree: MTP6 clusters with other rice MTPs, showing divergence from Arabidopsis thaliana orthologs .

  • SNP Diversity: High Tajima’s D values (0.3–4.8) indicate balancing selection, preserving functional alleles in rice populations .

  • Protein Conservation: MTP6 exhibits high sequence conservation across rice genotypes, with rare non-synonymous SNPs (<5% allele frequency) .

Functional Roles

  • Metal Transport: Facilitates vacuolar sequestration of metals (Zn, Mn, Fe, Cd, Co, Ni) to mitigate toxicity .

  • Co-localization with QTLs: Overlaps with quantitative trait loci (QTLs) linked to metal tolerance, though specific associations require further validation .

Production and Purification

ParameterDetails
Expression SystemE. coli or cell-free systems (His-tagged for purification)
Purity>85–90% (SDS-PAGE validated)
StorageLyophilized powder or Tris/PBS buffer with 6% trehalose (store at -20°C/-80°C)

Amino Acid Sequence:
MAAAAGVAAGTGRGSGEGEELLPNAVEGDGGCGGGGTCAGDRPWRLNFDGLRRPEAHQEK...
(Full sequence available in )

Challenges and Future Directions

  • Structural Discrepancies: Initial TMHMM predictions failed to detect transmembrane domains, necessitating 3D modeling for accurate topology .

  • Functional Gaps: Direct evidence for MTP6’s role in specific metal transport pathways remains limited.

  • Research Applications: Recombinant MTP6 is used in in vitro assays to study metal-binding kinetics and membrane integration .

Motif Distribution in MTP6

MotifDescription
Motif 1Conserved across MTP family; ligand-binding
Motif 2Phosphorylation site (TYR residues)
Motif 3Cytoskeleton interaction domain

Key Genomic Features

FeatureValue
Gene LocusOs05g0461900
Exon Count5–6
UTR Lengths~23–72 Mb in genome

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, we are happy to accommodate specific format requests. Please indicate your preference when placing the order, and we will prepare accordingly.
Lead Time
Delivery times may vary depending on the purchasing method and location. For specific delivery details, please consult your local distributors.
Note: All of our proteins are shipped with standard blue ice packs. If dry ice shipping is required, please communicate with us in advance as additional fees will apply.
Notes
Repeated freeze-thaw cycles are not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents are settled at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%, which can be used as a reference.
Shelf Life
The shelf life of our proteins is influenced by various factors, including storage conditions, buffer composition, storage temperature, and the protein's inherent stability.
Generally, liquid forms have a shelf life of 6 months at -20°C/-80°C. Lyophilized forms have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
We determine the tag type during production. If you have a specific tag requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
MTP6; Os05g0461900; LOC_Os05g38670; OJ1281_H05.16; OJ1525_A02.3; Metal tolerance protein 6; OsMTP6
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-376
Protein Length
full length protein
Species
Oryza sativa subsp. japonica (Rice)
Target Names
MTP6
Target Protein Sequence
MAAAAGVAAGTGRGSGEGEELLPNAVEGDGGCGGGGTCAGDRPWRLNFDGLRRPEAHQEK PPRRFHDRLGGLVQSPGDDVAEYYQQQSELLEGFNEMDTLTDRGFLPGMSKEECEKVARS EALAIRLSNIANMVLFAAKVYASIRSGSLAIIASTLDSLLDLLSGFILWFTAFSKKTSNP YRYPIGKRRMQPLGILVFASVMATLGLQIILESTRSLFYDGDTFRLTKEQEKWVVDIMLS VTSVKLLLVVYCRSFTNEILAIYTIRTWSMTVLENVHSLVGQSASPEYLQKLTYLCWNHH KAVRHIDTVRAYTFGSHYFVEVDIVLPCDMPLQEAHDIGEAPQEKLESLPEIERAFVHLD YEFTHQPEHARSHDTL
Uniprot No.

Target Background

Function
Metal tolerance protein 6 (MTP6) is involved in the sequestration of excess metal ions from the cytoplasm into vacuoles. This process is crucial for maintaining cellular metal homeostasis.
Database Links

KEGG: osa:4339024

Protein Families
Cation diffusion facilitator (CDF) transporter (TC 2.A.4) family, SLC30A subfamily
Subcellular Location
Vacuole membrane; Multi-pass membrane protein. Note=Tonoplast.

Q&A

How can recombinant MTP6 protein be expressed and purified for research purposes?

Recombinant OsMTP6 can be expressed using several different expression systems:

E. coli Expression System:

  • The full-length coding sequence (1-376aa) can be cloned into an expression vector with an N-terminal His-tag .

  • After transformation into E. coli, expression is induced following standard protocols.

  • The protein is purified as a lyophilized powder with >90% purity as determined by SDS-PAGE .

Storage and Handling:

  • Store at -20°C/-80°C upon receipt

  • Aliquoting is necessary for multiple use

  • Avoid repeated freeze-thaw cycles

  • Reconstitute in deionized sterile water to 0.1-1.0 mg/mL

  • Add 5-50% glycerol (final concentration) and aliquot for long-term storage

Alternative expression systems include yeast, baculovirus, and mammalian cell expression systems, which may offer advantages for proper folding and post-translational modifications .

What experimental evidence demonstrates the metal transport function of MTP6?

The metal transport function of MTP6 has been experimentally demonstrated through several approaches:

  • Heterologous Expression in Yeast:

    • Expression of MTP6 homologs (e.g., CsMTP6 from cucumber) in yeast cells led to increased Mn accumulation and restored growth of mutants hypersensitive to Mn .

    • CsMTP6 expression in wild-type yeast resulted in a cobalt-resistant phenotype and suppressed the Co-sensitive phenotype in Δmmt1Δmmt2 cells .

  • Mitochondrial Metal Content Analysis:

    • Measurement of metal content in isolated mitochondria from yeast cells expressing MTP6 showed altered levels of Fe and Mn compared to control cells .

    • Metal content was determined by flame atomic absorption spectrometry (AAS) after digestion with concentrated HNO3 at 160°C for 2 hours .

  • Subcellular Localization Studies:

    • When expressed in yeast and in protoplasts isolated from Arabidopsis cells, CsMTP6 localized to mitochondria .

    • Immunolocalization of CsMTP6 in cucumber membranes confirmed its association with mitochondria .

What is known about MTP6 gene expression regulation in rice?

While the search results don't provide specific information about OsMTP6 regulation, studies on CsMTP6 (cucumber homolog) provide insights:

  • Root expression and protein levels of CsMTP6 were significantly up-regulated under both Fe deficiency and excess conditions .

  • MTP6 expression was not affected by Mn availability, suggesting specific regulation by Fe but not Mn .

The regulation of MTP6 appears to be connected to iron homeostasis mechanisms, with expression changes occurring to maintain proper iron distribution between cellular compartments, particularly under conditions of suboptimal or excessive iron availability.

How does MTP6 contribute to metal homeostasis and tolerance mechanisms in rice?

MTP6 plays a crucial role in the intricate network of metal homeostasis in rice through several mechanisms:

Rice japonica varieties demonstrate significantly higher metal tolerance than indica and aus varieties, with about 57% of phenotypic variation in aluminum tolerance correlated with subpopulation, suggesting specialized adaptations in different rice subspecies .

How can site-directed mutagenesis be used to investigate the metal selectivity and transport mechanism of MTP6?

Site-directed mutagenesis represents a powerful approach to understanding the structure-function relationship of MTP6:

  • Key Residues for Targeted Mutagenesis:

    • Based on studies with related MTPs, mutations in histidine residues within the CDF signature sequence are critical. For example:

      • In PtdMTP1: H89K and H89A mutations abolished Zn transport

      • In AtMTP1: H90A abolished Zn transport

      • In OsMTP1: H90D abolished Zn transport but had no effect on Co transport while enhancing Fe tolerance

  • Experimental Design for Mutagenesis Studies:

    • Clone the full-length OsMTP6 cDNA into an expression vector

    • Introduce point mutations using PCR-based site-directed mutagenesis

    • Express wild-type and mutant proteins in metal-sensitive yeast strains

    • Assess yeast growth under varying metal concentrations

    • Measure metal accumulation in transformed yeast cells and isolated mitochondria

  • Residues of Interest Based on Related Proteins:

    • The mutations T86A/L91A in AtMTP1 conferred tolerance to high levels of Co

    • Changes in T86 yielded some level of Cd tolerance while still transporting Zn

    • In OsMTP1, the mutation L82F appears to confer a gain-of-function, allowing transport of Zn with enhanced affinity for Fe, Co, and Mn

A methodical mutational analysis focusing on conserved residues would help identify the critical amino acids determining metal selectivity and transport efficiency of OsMTP6.

What techniques can be used to investigate the in vivo function of MTP6 in rice plants?

Several complementary approaches can be employed to investigate MTP6 function in vivo:

  • CRISPR-Cas9 Gene Editing:

    • Generate MTP6 knockout or knockdown rice plants

    • Design guide RNAs targeting exons of the MTP6 gene

    • Analyze metal content in different tissues and organelles of mutant plants

    • Examine plant performance under varying metal stress conditions

  • Overexpression Studies:

    • Create transgenic rice plants overexpressing MTP6 under constitutive or inducible promoters

    • Assess changes in metal tolerance, accumulation, and distribution

    • Examine phenotypic effects on plant growth, morphology, and seed production similar to studies performed with other rice genes

  • Subcellular Localization:

    • Create MTP6-GFP fusion constructs for in vivo localization

    • Use techniques like leaf cell protoplast transformation or particle bombardment

    • Confirm mitochondrial localization using co-localization with mitochondrial markers

  • Transcriptome Analysis:

    • Compare gene expression profiles between wild-type and MTP6 mutant plants under various metal stress conditions

    • Identify downstream genes and pathways affected by MTP6 disruption

  • Phenotypic Characterization Under Metal Stress:

    • Expose plants to varying levels of Fe, Mn, and other metals

    • Measure physiological parameters (photosynthesis, growth, yield)

    • Quantify metal content in different tissues using AAS or ICP-MS

How does japonica rice MTP6 compare to MTP6 homologs in other rice subspecies and plant species?

Comparative analysis reveals important insights into the evolutionary and functional diversity of MTP6:

  • Comparison Between Rice Subspecies:

    • Japonica rice varieties demonstrate significantly higher metal tolerance than indica and aus varieties .

    • Approximately 57% of phenotypic variation in aluminum tolerance is correlated with subpopulation .

    • The genetic architecture of rice aluminum tolerance involves different genes and genomic regions associated with tolerance in different subpopulations .

  • Comparison with Other Plant Species:

    • CsMTP6 (cucumber): Localizes to mitochondria and contributes to Fe and Mn efflux from these organelles .

    • When expressed in yeast, CsMTP6 confers increased tolerance to manganese .

    • Expression of CsMTP6 in Arabidopsis thaliana also increased manganese tolerance .

  • Evolutionary Relationships:

    • Rice and Arabidopsis appear to have experienced independent genome-wide duplication events, yet they share similar sets of functional domains among protein sequences .

    • Natural selection may have played a role in the evolution of duplicated genes in both species .

    • The distribution of paralog clusters is similar between rice and Arabidopsis, suggesting common selective pressures on gene duplication .

A detailed phylogenetic analysis revealed that MTP proteins fall into three distinct subgroups: Zn-CDF, Fe/Zn-CDF, and Mn-CDF, with MTP6 proteins belonging to the Fe/Zn-CDF subgroup .

What are the implications of MTP6 function for improving metal tolerance in rice crops?

Understanding MTP6 function offers several promising approaches for crop improvement:

  • Development of Metal-Tolerant Rice Varieties:

    • Overexpression of MTP6 might improve rice tolerance to iron and manganese toxicity, which are common problems in waterlogged rice paddies.

    • QTL analysis and bi-parental mapping can identify favorable MTP6 alleles in tolerant varieties for marker-assisted breeding .

    • Recent field experiments with japonica rice cultivars (2018-2023) demonstrate the importance of optimizing growing conditions for these varieties, with findings showing that total grain yield in control conditions averaged 8.5 t per hectare .

  • Biotechnological Applications:

    • Engineering MTP6 expression levels or activity could enhance iron use efficiency.

    • Creating rice varieties with improved adaptation to soils with varying metal content.

    • Potentially utilizing MTP6 in phytoremediation applications for metal-contaminated soils.

  • Adaptation to Climate Change:

    • Recent research (2025) on japonica rice cultivars under agrivoltaic systems shows their adaptability to reduced light conditions, with grain yields of 6.5 t per hectare compared to 8.5 t per hectare in control conditions .

    • Understanding metal homeostasis mechanisms is crucial as changing environmental conditions may alter metal availability in soils.

  • Integration with Other Metal Tolerance Mechanisms:

    • Combining MTP6 optimization with other known tolerance genes like Nrat1 (aluminum tolerance) .

    • Leveraging the naturally higher metal tolerance of japonica varieties to develop improved varieties with multiple tolerance traits.

Comparison of Metal Tolerance Across Rice Subpopulations
Varietal Group
Japonica
Indica
Admixed

Table represents aluminum tolerance as measured by relative root growth (RRG) across different rice subpopulations

What are the optimal conditions for expressing and purifying recombinant MTP6 protein with maximum yield and activity?

Based on available information for recombinant MTP6 and related proteins, the following protocol outlines optimal conditions:

  • Expression System Selection:

    • E. coli: Highest yield but may have folding issues for membrane proteins

    • Yeast: Better for functional studies as demonstrated with CsMTP6

    • Baculovirus or mammalian systems: May provide better folding for complex proteins

  • Expression Construct Design:

    • Add N-terminal His-tag for affinity purification

    • Consider codon optimization for the expression system

    • Include TEV or other protease cleavage sites if tag removal is desired

  • E. coli Expression Protocol:

    • Culture conditions: LB medium, 37°C for growth, induce at OD600 = 0.6-0.8

    • Induction: 0.1-1.0 mM IPTG, shift to lower temperature (16-25°C)

    • Harvest: 16-24 hours post-induction

  • Purification Strategy:

    • Cell lysis: Sonication or French press in Tris/PBS-based buffer

    • IMAC purification: Ni-NTA or similar affinity resin

    • Further purification: Size exclusion chromatography if needed

    • Final buffer: Tris/PBS-based buffer, pH 8.0, containing 6% trehalose

  • Storage for Maximum Stability:

    • Lyophilize or store in buffer with 50% glycerol

    • Aliquot to avoid freeze-thaw cycles

    • Store at -80°C for long-term or -20°C for medium-term storage

  • Reconstitution for Activity Assays:

    • Reconstitute in deionized sterile water to 0.1-1.0 mg/mL

    • For long-term storage of reconstituted protein, add glycerol to 5-50% final concentration

The purity should be greater than 90% as determined by SDS-PAGE , and functionality can be verified through metal transport assays in proteoliposomes or complementation of metal-sensitive yeast strains.

How can metal transport activity of MTP6 be measured in vitro and in vivo?

Multiple complementary approaches can be used to assess MTP6 metal transport activity:

In Vitro Methods:

  • Proteoliposome Metal Transport Assays:

    • Reconstitute purified MTP6 into liposomes

    • Incubate with radioactive metal isotopes (55Fe, 54Mn)

    • Measure metal uptake using filtration and scintillation counting

    • Compare transport rates with various metals to determine specificity

  • Membrane Vesicle Transport Assays:

    • Isolate membrane vesicles from cells expressing MTP6

    • Measure metal transport using fluorescent metal indicators or isotopes

    • Use ionophores and inhibitors to determine transport direction and mechanism

In Vivo Methods:

  • Yeast Functional Complementation:

    • Express MTP6 in metal-sensitive yeast mutants

    • Measure growth restoration on metal-containing media

    • Quantify cellular metal content by AAS or ICP-MS

  • Isolated Mitochondria Metal Measurements:

    • Isolate mitochondria from cells expressing MTP6

    • Digest samples with concentrated HNO3 at 160°C for 2h

    • Measure metal content by flame atomic absorption spectrometry (AAS)

    • Compare metal levels between wild-type and MTP6-expressing systems

  • Plant Metal Distribution Analysis:

    • Generate transgenic plants with altered MTP6 expression

    • Separate cellular fractions (mitochondria, cytosol)

    • Quantify metals in each fraction

    • Use synchrotron X-ray fluorescence microscopy for in situ metal localization

For example, in studies with CsMTP6, mitochondria were isolated using a four-step sucrose gradient (60/32/23/15%), with intact mitochondria collected from the 60/32% interface .

What advanced genetic approaches can be used to study MTP6 gene function in rice germplasm?

Several cutting-edge genetic approaches are applicable for studying MTP6 function:

  • Genome-Wide Association Studies (GWAS):

    • Screen diverse rice germplasm for metal tolerance phenotypes

    • Perform high-density SNP genotyping (700,000+ SNPs)

    • Identify loci associated with metal tolerance that may interact with MTP6

    • Link phenotypic variation to genetic polymorphisms in or near MTP6

  • Ancestral Recombination Graph (ARG) Analysis:

    • Construct ARGs encoded as tree sequences for both indica and japonica rice

    • Use branch-based relationship matrices (BRMs) for improved quantitative genetic analyses

    • Apply this approach to understand the evolution of MTP6 alleles across subspecies

    • This method has shown the highest predictive ability when combining both subspecies in genetic analyses

  • CRISPR-Cas Genome Editing:

    • Generate precise MTP6 knockouts, knockdowns, or promoter modifications

    • Create allelic series by introducing specific mutations in functional domains

    • Develop base editing approaches for subtle modifications of key residues

    • Employ CRISPR-Cas13 for RNA-level interference if protein is essential

  • InDel Marker Development:

    • Develop InDel markers around the MTP6 locus based on whole-genome resequencing data

    • Use these markers for genetic mapping and association studies

    • These markers function like SSRs in identifying hybrids, calculating genetic distance, constructing genetic linkage maps, and gene mining

  • Bi-Parental QTL Mapping:

    • Develop mapping populations between contrasting japonica and indica varieties

    • Evaluate metal tolerance using multiple indices (e.g., longest root growth, primary root growth, total root growth)

    • Identify QTLs associated with MTP6 and metal tolerance

Recent research has demonstrated the effectiveness of these approaches in rice, with GWAS studies identifying 97 loci associated with blast resistance, of which 82 were new regions .

How can structural biology approaches be used to understand MTP6 metal transport mechanisms?

Structural biology offers powerful insights into MTP6 function through these methodologies:

  • Homology Modeling:

    • Use crystal structures of related CDF transporters as templates

    • For example, the E. coli YiiP structure has been determined and can serve as a template

    • Generate models of OsMTP6 in different conformational states

    • Predict metal binding sites and transmembrane topology

  • Molecular Dynamics Simulations:

    • Simulate MTP6 in a lipid bilayer environment

    • Investigate conformational changes during the transport cycle

    • Model interactions with metal ions to understand selectivity

    • Predict effects of mutations on protein structure and function

  • Protein Crystallography:

    • Express and purify large quantities of recombinant MTP6

    • Screen for crystallization conditions

    • Determine high-resolution structure through X-ray crystallography

    • Co-crystallize with bound metals to identify binding sites

  • Cryo-Electron Microscopy:

    • Suitable for membrane proteins difficult to crystallize

    • Determine structure in a near-native environment

    • Capture different conformational states of the transport cycle

  • Site-Directed Spin Labeling and EPR Spectroscopy:

    • Introduce spin labels at specific residues

    • Measure distances between labeled sites to track conformational changes

    • Monitor protein dynamics during transport

The CDF signature sequence proposed by Paulsen and Saier (1997) and modified by Montanini et al. (2007) is highly conserved between species and important for metal transport and specificity . Structural studies focusing on this region would be particularly informative for understanding MTP6 function.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.