Recombinant Oryza sativa subsp. japonica Metal tolerance protein 7 (MTP7)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have a specific format requirement, please include it in your order notes, and we will fulfill your request.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributor for specific delivery timeframes.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipment, please inform us in advance. Additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For optimal preservation, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial prior to opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we suggest adding 5-50% glycerol (final concentration) and aliquotting the solution at -20°C/-80°C. Our standard glycerol final concentration is 50%, which can be used as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer components, temperature, and the inherent stability of the protein.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The shelf life of the lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquotting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
MTP7; Os01g0130000; LOC_Os01g03914; OsJ_00239; P0408F06.28; P0504H10.3; Metal tolerance protein 7; OsMTP7
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-391
Protein Length
full length protein
Species
Oryza sativa subsp. japonica (Rice)
Target Names
MTP7
Target Protein Sequence
MGSRGRRGGGERETETEEDETWKLRVGDDFTVPERFHRKPPFFSRIFPAGSHGKHRKIAK YYKKQENLLKDFSEMETMNEIGSLDQNAPTEEELRQMAKGERLAINLSNIINLILFIGKV LASVESLSMAVIASTLDSLLDLLSGFILWFTAHAMKKPNKYSYPIGKRRMQPVGIIVFAS VMGTLGFQVLIESGRQLITNEHQVFDHRKELWMIGSMSSVAVVKFFLMLYCRSFKNEIVR AYAQDHFFDVITNSVGLVSALLAVRYKWWMDPVGAILIAVYTITTWARTVVENVGTLIGR SAPAEYLTKLTYLIWNHHEEIRHIDTVRAYTFGTHYFVEVDIVLPGDMPLSHAHDIGESL QEKLEQLPEVERAFVHVDFEFTHRPEHKAEV
Uniprot No.

Target Background

Function
Metal tolerance protein 7 (MTP7) plays a crucial role in regulating metal homeostasis by sequestering excess metal from the cytoplasm into vacuoles.
Database Links
Protein Families
Cation diffusion facilitator (CDF) transporter (TC 2.A.4) family, SLC30A subfamily
Subcellular Location
Vacuole membrane; Multi-pass membrane protein. Note=Tonoplast.

Q&A

What is Metal Tolerance Protein 7 (MTP7) and what is its function in rice?

Metal Tolerance Protein 7 (OsMTP7) is a member of the cation diffusion facilitator (CDF) family in rice (Oryza sativa subsp. japonica). As indicated by its amino acid sequence and structural features, it plays a crucial role in metal ion homeostasis and detoxification . The protein contains transmembrane domains characteristic of metal transporters, suggesting its involvement in metal ion transport across cellular membranes. OsMTP7's primary function likely involves sequestration or efflux of specific metal ions to maintain cellular metal homeostasis and confer tolerance to potential metal toxicity.

Similar to other characterized MTP family members in rice, such as OsMTP11 which has been shown to mediate manganese (Mn), cobalt (Co), and nickel (Ni) tolerance , OsMTP7 may have specific metal ion preferences and transport mechanisms. Based on sequence analysis, OsMTP7 consists of 391 amino acids and is encoded by the MTP7 gene (Os01g0130000, LOC_Os01g03914) .

What is the expression pattern of OsMTP7 in different rice tissues and developmental stages?

While the search results don't provide specific information about OsMTP7 expression patterns, we can make educated inferences based on protocols used for rice transcriptome analysis. Comprehensive analysis of gene expression in rice typically involves sampling from multiple tissues at various developmental stages.

For accurate determination of OsMTP7 expression patterns, researchers should collect samples from different organs including leaves, panicles, inflorescences, roots, and seeds at various developmental stages . For seed and panicle development specifically, sampling at 5, 10, 15, 20, 25, and 30 days post-anthesis (DPA) provides a comprehensive view of temporal expression changes .

Expression analysis can be performed using quantitative real-time PCR (qRT-PCR), RNA-Seq, or specialized methods like PacBio long-read sequencing to detect potential splice variants . Based on studies of related proteins like OsMTP11, metal tolerance genes often show tissue-specific expression patterns and may be induced under metal stress conditions .

How can I investigate the metal specificity of OsMTP7 and its transport mechanism?

Investigating the metal specificity and transport mechanism of OsMTP7 requires a multi-faceted approach combining heterologous expression systems, metal accumulation assays, and transport kinetics studies.

Heterologous Expression Approach:

  • Express OsMTP7 in metal-sensitive yeast mutants (similar to approaches used for OsMTP11 )

  • Perform complementation assays under various metal stresses (Mn, Zn, Cd, Co, Ni)

  • Generate growth curves of transformed yeast under different metal concentrations

  • Measure metal content in yeast cells expressing OsMTP7 versus controls

Mechanistic Investigation:

  • Use fluorescently-tagged OsMTP7 to determine subcellular localization

  • Employ pH-sensitive fluorescent probes to assess whether transport is proton-coupled

  • Perform site-directed mutagenesis of predicted metal-binding sites

  • Use radioactive or isotope-labeled metals to track transport in real-time

Based on studies with OsMTP11, which mediates Mn, Co, and Ni tolerance through extracellular excretion rather than vacuolar sequestration, it's important to determine whether OsMTP7 functions through similar or different mechanisms .

What epigenetic mechanisms might regulate OsMTP7 expression under metal stress conditions?

Epigenetic regulation, particularly DNA methylation, may play a crucial role in controlling OsMTP7 expression under metal stress. Based on findings from OsMTP11 research, heavy metal stress can alter the methylation status of CpG islands in promoter regions, affecting gene expression .

To investigate potential epigenetic regulation of OsMTP7:

  • Analyze the OsMTP7 promoter region for CpG islands using bioinformatic tools

  • Perform bisulfite sequencing to detect changes in DNA methylation at CG, CHG, and CHH sites under various metal stresses

  • Correlate methylation patterns with expression levels using qRT-PCR

  • Use chromatin immunoprecipitation (ChIP) to analyze histone modifications at the OsMTP7 locus

Studies on OsMTP11 revealed decreased methylation rates at CG, CHG, and CHH sites in the promoter region under cadmium, zinc, nickel, and manganese treatments, corresponding with increased gene expression . This suggests that DNA methylation might be a conserved regulatory mechanism for metal tolerance genes in rice.

How can alternative splicing affect the function of OsMTP7, and how do I identify splice variants?

Alternative splicing (AS) can significantly impact protein function by altering domain structures, localization signals, or creating truncated variants. For thorough investigation of OsMTP7 splice variants:

Identification Approach:

  • Perform PacBio Iso-Seq or other long-read sequencing to capture full-length transcripts

  • Design RT-PCR primers spanning expected splice junctions

  • Use bioinformatic tools to analyze potential AS events from transcriptome data

  • Validate novel splice variants with Sanger sequencing

Functional Analysis:

  • Express identified splice variants in heterologous systems

  • Compare metal tolerance capabilities among variants

  • Examine subcellular localization differences

  • Assess protein-protein interaction profiles of different isoforms

Based on transcriptome studies in rice, intron retention is the most prevalent alternative splicing event, followed by alternative splice sites, while exon skipping is least common . Rice transcriptome analysis has identified numerous novel splice junctions with both canonical and non-canonical intron boundaries , suggesting OsMTP7 may exhibit similar splicing complexity.

What is the optimal protocol for expressing and purifying recombinant OsMTP7 for functional studies?

Expression and purification of membrane proteins like OsMTP7 present unique challenges due to their hydrophobic nature and need for proper folding. Based on established protocols for metal transporters:

Expression Systems:

  • Bacterial expression (E. coli): Use specialty strains (C41, C43) designed for membrane protein expression

  • Yeast expression (P. pastoris): Provides eukaryotic folding machinery

  • Insect cell expression (Sf9, Hi5): Higher yield of properly folded complex proteins

Purification Protocol:

  • Membrane fraction isolation via ultracentrifugation

  • Solubilization using mild detergents (DDM, LMNG)

  • Affinity chromatography using terminal tags (His-tag recommended)

  • Size exclusion chromatography for final purification

Storage Considerations:
Store purified OsMTP7 in Tris-based buffer with 50% glycerol at -20°C to maintain stability. For extended storage, -80°C is recommended. Avoid repeated freeze-thaw cycles .

What analytical techniques are most effective for studying metal transport activity of OsMTP7?

Several complementary techniques can effectively characterize the metal transport activity of OsMTP7:

In Vitro Approaches:

  • Reconstitution in proteoliposomes: Incorporate purified OsMTP7 into artificial liposomes loaded with fluorescent metal indicators

  • Isothermal titration calorimetry (ITC): Determine binding affinities for different metal ions

  • Stopped-flow spectroscopy: Measure real-time transport kinetics

  • Inductively coupled plasma mass spectrometry (ICP-MS): Quantify metal content with high precision

Cellular Approaches:

  • Metal-sensitive fluorescent probes: Monitor intracellular metal concentrations in live cells

  • Radioactive metal uptake assays: Track movement of labeled metals

  • Yeast complementation assays: Functional assessment in metal-sensitive yeast strains

  • Electrophysiology: Record transport-associated currents in Xenopus oocytes

These techniques should be combined with appropriate controls, including inactive protein mutants and varying metal ion concentrations, to comprehensively characterize OsMTP7's transport properties.

How can I design experiments to study the physiological role of OsMTP7 in planta?

To elucidate the physiological role of OsMTP7 in rice plants, a comprehensive experimental approach combining genetic, molecular, and physiological methods is recommended:

Genetic Approaches:

  • CRISPR-Cas9 gene editing: Generate knockout and knockdown lines

  • Overexpression studies: Create transgenic lines with constitutive or inducible OsMTP7 expression

  • Promoter-reporter fusions: Visualize spatial and temporal expression patterns

Phenotypic Characterization:

  • Evaluate growth responses under various metal stress conditions

  • Measure metal content in different tissues using ICP-MS

  • Assess physiological parameters (photosynthetic efficiency, root development)

  • Analyze stress marker expression (ROS production, antioxidant enzyme activity)

Table 1: Suggested Experimental Design for Metal Stress Treatments

Treatment TypeMetal Concentration RangeDurationTissue Collection Timepoints
Manganese (Mn)0.5-2.0 mM MnSO₄0-72h4h, 12h, 24h, 48h, 72h
Zinc (Zn)1.0-5.0 mM ZnSO₄0-72h4h, 12h, 24h, 48h, 72h
Cadmium (Cd)0.1-0.5 mM CdCl₂0-72h4h, 12h, 24h, 48h, 72h
Nickel (Ni)0.5-1.0 mM NiCl₂0-72h4h, 12h, 24h, 48h, 72h

This experimental design is based on conditions used to study OsMTP11 expression in response to heavy metal stresses and should be adjusted based on preliminary results.

How should I analyze transcriptome data to identify regulatory networks involving OsMTP7?

Analyzing transcriptome data to uncover regulatory networks involving OsMTP7 requires sophisticated bioinformatic approaches:

Data Processing Workflow:

  • Quality control and normalization of RNA-Seq or long-read sequencing data

  • Differential expression analysis across tissues and stress conditions

  • Co-expression network construction using WGCNA or similar tools

  • Identification of transcription factors potentially regulating OsMTP7

  • Enrichment analysis of co-expressed genes for pathway detection

Validation Strategy:

  • Confirm key interactions with qRT-PCR

  • Perform ChIP-seq to identify direct binding of predicted transcription factors

  • Use yeast one-hybrid assays to validate protein-DNA interactions

  • Apply EMSA (electrophoretic mobility shift assay) to confirm binding specificity

For complex transcriptome analysis in rice, PacBio long-read sequencing has proven valuable for capturing full-length transcripts and novel isoforms . This approach revealed extensive transcript diversity in rice, with numerous alternatively spliced variants that could be relevant to metal tolerance networks .

What bioinformatic tools are recommended for analyzing the structure-function relationship of OsMTP7?

Several bioinformatic tools and approaches can help elucidate the structure-function relationship of OsMTP7:

Sequence Analysis:

  • Multiple sequence alignment: Compare OsMTP7 with characterized MTPs (MUSCLE, Clustal Omega)

  • Motif identification: Detect conserved metal-binding and transport motifs (MEME, PROSITE)

  • Phylogenetic analysis: Determine evolutionary relationships (MEGA, PhyML)

Structural Prediction:

  • Transmembrane topology: Predict membrane-spanning regions (TMHMM, Phobius)

  • 3D structure modeling: Generate structural models using homology or AI-based approaches (AlphaFold, SWISS-MODEL)

  • Molecular dynamics simulations: Assess conformational changes during transport cycles

Functional Annotation:

  • Gene Ontology enrichment: Identify associated biological processes

  • Protein-protein interaction prediction: Discover potential interacting partners

  • Variant effect prediction: Assess impact of amino acid substitutions on function

Analysis of the OsMTP7 protein sequence (391 amino acids) reveals transmembrane domains characteristic of metal transporters, suggesting its involvement in metal ion transport across cellular membranes . Comparative analysis with other characterized MTPs can provide insights into metal specificity and transport mechanisms.

How can understanding OsMTP7 function contribute to developing metal-tolerant rice varieties?

Understanding OsMTP7 function has significant implications for crop improvement, particularly for developing rice varieties with enhanced metal tolerance:

Translational Applications:

  • Marker-assisted selection: Identify beneficial OsMTP7 alleles in germplasm

  • Genetic engineering: Create transgenic lines with optimized OsMTP7 expression

  • Genome editing: Modify key regulatory elements to enhance metal tolerance

  • Pyramiding strategies: Combine OsMTP7 with other metal tolerance genes

Potential Benefits:

  • Development of rice varieties suitable for cultivation in metal-contaminated soils

  • Biofortification approaches to enhance essential micronutrient content

  • Reduced metal toxicity in rice grown in acidic soils with high metal bioavailability

  • Improved crop yield and food security in areas with metal-contaminated agricultural land

Research on OsMTP11 has shown that its expression is induced by multiple heavy metals (Mn, Cd, Zn, Ni) and that it confers tolerance through extracellular excretion mechanisms . Similar studies on OsMTP7 could reveal unique properties that might be leveraged for crop improvement.

What new methodologies are emerging for studying metal transporter functions that could be applied to OsMTP7?

The field of metal transporter research is rapidly evolving, with several cutting-edge technologies that could enhance our understanding of OsMTP7:

Emerging Technologies:

  • Cryo-EM: Determine high-resolution structures of membrane transporters in different conformational states

  • Single-molecule FRET: Track conformational changes during transport cycles

  • Nanobody-based biosensors: Detect specific protein conformations in live cells

  • CRISPR-based transcriptional modulators: Fine-tune expression in specific tissues

Advanced Analytical Methods:

  • Single-cell transcriptomics: Uncover cell-type specific expression patterns

  • Spatial transcriptomics: Map expression within complex tissues

  • Metabolomics integration: Connect metal transport to downstream metabolic effects

  • Multi-omics approaches: Combine genomics, transcriptomics, proteomics, and ionomics data

These emerging technologies could provide unprecedented insights into OsMTP7 function, revealing aspects of its regulation and activity that are currently inaccessible with conventional methods.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.