Recombinant Oryza sativa subsp. japonica Metal tolerance protein 8 (MTP8)

What is the molecular structure and sequence of MTP8?

MTP8 is a 316-amino acid protein involved in metal ion transport in japonica rice. The full amino acid sequence is:

MGPVRHILNERKSRKIAAFLLINTAYMFVEFTSGFMSDSLGLISDACHMLFDCAALAIGL YASYIARLPANGLYNYGRGRFEVLSGYVNAVFLVLVGALIVLESFERILEPREISTSSLL TVSIGGLVVNVIGLVFFHEEHHHAHGEAHSCNGGLQSSENHNKSRNRHHIDHNMEGIFLH VLADTMGSVGVVISTLLIKYKGWLIADPICSVFISIMIVSSVLPLLRNSAEILLQRVPRS LEKDIKEALDDVMKIKGVIGVHNFHVWNLTNTDIVGTFHLHITTEADKSSIREKASDIFH EAGIQDLTIQIECVKR

The protein contains transmembrane domains typical of metal transporters, with conserved histidine-rich regions that likely participate in metal binding. For structural analysis, researchers typically employ predictive modeling based on homologous metal transporters, as the crystal structure has not been definitively resolved.

What are the genetic identifiers and synonyms for MTP8?

When conducting literature searches or database queries, researchers should be aware of multiple identifiers for this gene:

These identifiers are essential for comprehensive database searches when compiling literature for experimental design or comparative analyses .

What expression systems are optimal for recombinant MTP8 production?

For functional studies of MTP8, E. coli expression systems have been successfully employed. The recombinant protein is typically expressed with an N-terminal His-tag to facilitate purification . When designing expression vectors, researchers should consider the following:

• Codon optimization for E. coli if expressing the full-length protein

• Signal peptide removal for improved expression

• Temperature reduction (to 18-20°C) during induction to minimize inclusion body formation

• IPTG concentration optimization (typically 0.1-0.5 mM)

For membrane proteins like MTP8, alternative expression systems such as yeast (Pichia pastoris) may provide better folding and functional expression for activity studies, although E. coli remains suitable for structural analyses.

What purification strategies yield highest purity and activity of MTP8?

Purification of His-tagged MTP8 typically follows a multi-step protocol:

• Initial capture using Ni-NTA affinity chromatography (imidazole gradient: 20-250 mM)

• Buffer exchange to remove imidazole (using dialysis or gel filtration)

• Optional secondary purification via ion exchange chromatography

• Final polishing step using size exclusion chromatography

For optimal results, maintain reducing conditions (1-5 mM β-mercaptoethanol or DTT) throughout purification to prevent oxidation of cysteine residues. Purification under these conditions typically yields >90% purity as determined by SDS-PAGE .

Storage recommendations include aliquoting at 0.1-1.0 mg/mL with 50% glycerol and storing at -20°C/-80°C to prevent freeze-thaw damage. When working with purified MTP8, avoid repeated freeze-thaw cycles, as these significantly reduce protein activity .

How does MTP8 contribute to metal homeostasis in japonica rice?

MTP8 belongs to the Cation Diffusion Facilitator (CDF) family of transporters, which typically mediate efflux of transition metal ions from the cytoplasm to external media or into internal compartments. In japonica rice, MTP8 is implicated in manganese tolerance and homeostasis, with research suggesting its involvement in sequestering excess Mn2+ into vacuoles.

The protein's function should be investigated through multiple complementary approaches:

• Heterologous expression in metal-sensitive yeast mutants

• In vitro metal transport assays using reconstituted proteoliposomes

• Subcellular localization studies using GFP fusion proteins

• Metal content analysis in MTP8-overexpressing and knockdown/knockout lines

When comparing japonica varieties to other rice subspecies, researchers should consider the genetic background effects, as genetic structure studies have demonstrated significant divergence between japonica and indica rice subspecies .

How can metal binding and transport activity of MTP8 be measured quantitatively?

Several experimental approaches can quantify MTP8's metal transport activity:

For comprehensive characterization, researchers should employ multiple methods to overcome the limitations of any single approach.

How can MTP8 be utilized to investigate metal stress responses in rice?

MTP8 represents an excellent molecular tool for investigating metal stress mechanisms. Experimental approaches include:

• Transgenic overexpression of MTP8 to assess enhanced metal tolerance

• CRISPR/Cas9-mediated knockout to evaluate loss-of-function phenotypes

• Promoter-reporter fusions to monitor stress-responsive expression

• Protein-protein interaction studies to identify regulatory partners

When designing metal stress experiments, researchers should carefully control growth conditions, as environmental factors significantly influence metal availability and toxicity. Additionally, comparing responses across genetically diverse rice varieties can provide insights into adaptive mechanisms, particularly given the documented genetic differentiation between japonica and other rice subspecies .

What techniques effectively assess MTP8 expression patterns under varying environmental conditions?

Multiple approaches can characterize MTP8 expression patterns:

• Quantitative RT-PCR for transcript abundance measurement

• Western blotting for protein level analysis

• GUS or LUC reporter systems for spatiotemporal expression patterns

• RNA-seq for transcriptome-wide context of MTP8 regulation

When interpreting expression data, researchers should consider the phylogenetic relationships among rice varieties. Studies have shown that japonica rice has experienced different demographic history compared to indica varieties, which may influence stress response pathways . Additionally, methylation patterns, which have been characterized as phylogenetically clustered in japonica rice , may impact MTP8 expression under stress conditions.

How do epigenetic modifications affect MTP8 expression in japonica rice?

DNA methylation represents an important regulatory mechanism for gene expression in plants, particularly for stress-responsive genes. Research on japonica rice has revealed that methylation patterns are often phylogenetically clustered and can influence gene expression .

For studying methylation effects on MTP8, consider:

• Bisulfite sequencing of the MTP8 promoter region under various stress conditions

• Chromatin immunoprecipitation (ChIP) to identify histone modifications

• Treatment with demethylating agents (e.g., 5-azacytidine) to assess expression changes

• Comparison of methylation patterns between japonica and other rice subspecies

The methylation status should be interpreted in context of the evolutionary history of japonica rice, as research has shown that methylation patterns correlate with phylogenetic relationships and insertion times of genomic elements .

What evolutionary insights can comparative analysis of MTP8 across Oryza species provide?

Evolutionary analysis of MTP8 can reveal important insights about functional conservation and adaptation. Approaches should include:

• Phylogenetic analysis of MTP8 orthologs across Oryza species and outgroups

• Selection pressure analysis using dN/dS ratios

• Protein structure prediction and comparison of conserved domains

• Functional complementation studies across species

When performing comparative analyses, researchers should consider the documented genetic structure in Oryza sativa, which includes five distinct groups: indica, aus, aromatic, temperate japonica, and tropical japonica . Pairwise genetic differentiation (FST) values between these groups range from 0.20 to 0.42, with temperate and tropical japonica showing closer relationships (FST = 0.20) .

How can protein engineering enhance MTP8 functional properties for biotechnological applications?

Structure-guided protein engineering can enhance MTP8 properties for both research and potential biotechnological applications:

• Site-directed mutagenesis of metal-binding residues to alter metal specificity

• Domain swapping with other metal transporters to create chimeric proteins

• Stability enhancement through computational design of stabilizing mutations

• Fluorescent protein fusions for real-time activity monitoring

Engineering efforts should be guided by structural predictions and evolutionary conservation analysis. The full amino acid sequence provided in the product information serves as the foundation for identifying critical functional residues for modification.

How can researchers address protein solubility issues when working with recombinant MTP8?

As a membrane protein, MTP8 presents solubility challenges that can be addressed through several strategies:

• Detergent screening (start with mild detergents like DDM, LMNG, or CHAPS)

• Expression of truncated constructs lacking hydrophobic regions

• Fusion with solubility-enhancing tags (MBP, SUMO, or TrxA)

• Co-expression with molecular chaperones (GroEL/ES or DnaK/J-GrpE systems)

For functional studies requiring native conformation, consider nanodiscs or liposome reconstitution as alternatives to detergent solubilization.

When reconstituting the lyophilized protein, follow the recommended protocol: reconstitute in deionized sterile water to 0.1-1.0 mg/mL, add glycerol to 5-50% final concentration (50% recommended), and aliquot for long-term storage at -20°C/-80°C .