Recombinant Oryza sativa subsp. japonica MLO protein homolog 1 (MLO1)

Shipped with Ice Packs
In Stock

Description

Functional Roles in Plant Defense

MLO1 is a susceptibility factor that negatively regulates resistance to powdery mildew and blast fungi . Key functional insights include:

  • Pathogen Interaction: MLO1 facilitates fungal penetration by modulating cell wall integrity. Knockout mutants exhibit enhanced resistance to Magnaporthe oryzae (rice blast) .

  • Calmodulin Binding: Activity is regulated by Ca²⁺-dependent calmodulin binding, independent of heterotrimeric G proteins .

  • Domain Architecture:

    • Leucine-rich repeats (LRRs) for pathogen recognition.

    • Transmembrane helices for signal transduction .

Comparative Analysis with Indica Subspecies

The japonica MLO1 (UniProt: Q0DC45) differs from indica MLO1 (UniProt: A2YD22) by four amino acid substitutions, localized in extracellular loops critical for pathogen interaction .

FeatureJaponica MLO1Indica MLO1
UniProt IDQ0DC45A2YD22
Key ResiduesPhe¹⁷⁸, Asn³²⁰Ser¹⁷⁸, Ser³²⁰
Expression Yield~0.1–1.0 mg/mL after reconstitutionSimilar
Pathogen SpecificityBroad-spectrum susceptibilityStrain-dependent susceptibility

4.1. Disease-Resistance Engineering

CRISPR/Cas9-mediated knockout of MLO1 in rice confers durable resistance to blast and bacterial blight pathogens . For example:

  • Edited MLO1 lines reduced Magnaporthe oryzae infection by 70% compared to wild-type plants .

  • Mechanism: Disrupted MLO1 prevents effector-triggered susceptibility (ETS) by impeding fungal hyphae penetration .

Future Directions

  • Gene Stacking: Combining MLO1 knockouts with R genes (e.g., XA21) for broad-spectrum resistance .

  • Synthetic Biology: Engineering MLO1 variants with reduced pathogen affinity while retaining native signaling functions .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them during order placement, and we will fulfill your request.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributor for specific delivery timelines.
Note: Our proteins are shipped with standard blue ice packs. If dry ice shipping is required, please communicate with us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle to the bottom. Please reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final glycerol concentration is 50%, which can be used as a reference.
Shelf Life
Shelf life is influenced by various factors including storage conditions, buffer components, temperature, and the protein's inherent stability.
Generally, liquid forms have a shelf life of 6 months at -20°C/-80°C. Lyophilized forms have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production. If you have specific tag type requirements, please inform us and we will prioritize developing the specified tag.
Synonyms
MLO1; MLO-H1; Os06g0486300; LOC_Os06g29110; OJ1568_D07.18; P0008F02.13; MLO protein homolog 1; OsMLO1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-540
Protein Length
full length protein
Species
Oryza sativa subsp. japonica (Rice)
Target Names
MLO1
Target Protein Sequence
MAGGRSGSRELPETPTWAVAVVCAVLVLVSVAMEHGLHNLSHWFRRRQKKAMGDALDKIK AELMLLGFISLLLTVAQAPISKICIPKSAANILLPCKAGQDAIEEEAASDRRSLAGAGGG DYCSKFDGKVALMSAKSMHQLHIFIFVLAVFHVTYCVITMGLGRLKMKKWKKWESQTNSL EYQFAIDPSRFRFTHQTSFVKRHLGSFSSTPGLRWIVAFFRQFFGSVTKVDYLTMRQGFI NAHLSQNSKFDFHKYIKRSLEDDFKVVVGISLPLWFVGILVLFLDIHGLGTLIWISFVPL IIVLLVGTKLEMVIMQMAQEIQDRATVIQGAPVVEPSNKYFWFNRPDWVLFFIHLTLFHN AFQMAHFVWTMATPGLKKCFHENIWLSIVEVIVGISLQVLCSYITFPLYALVTQMGSNMK KTIFEEQTMKALMNWRKKAMEKKKVRDADAFLAQMSVDFATPASSRSASPVHLLQDHRAR SDDPPSPITVASPPAPEEDIYPVPAAAASRQLLDDPPDRRWMASSSADIADSDFSFSAQR
Uniprot No.

Target Background

Function
This protein may be involved in regulating pathogen defense and leaf cell death. Its activity appears to be modulated by Ca(2+)-dependent calmodulin binding and does not seem to require heterotrimeric G proteins.
Database Links
Protein Families
MLO family
Subcellular Location
Membrane; Multi-pass membrane protein.

Q&A

What is MLO1 protein and what is its significance in rice biology?

MLO1 (MLO protein homolog 1) is a transmembrane protein belonging to the MLO family, originally identified in Oryza sativa subsp. japonica. The full-length protein consists of 540 amino acids and plays crucial roles in cellular defense responses and susceptibility to powdery mildew pathogens. Understanding MLO1 function is significant for elucidating plant-pathogen interactions in rice and developing disease-resistant varieties . The protein is encoded by the MLO1 gene (also known as MLO-H1, Os06g0486300, LOC_Os06g29110) and has several synonyms including OsMLO1 .

What are the structural characteristics of recombinant MLO1 protein?

The recombinant full-length Oryza sativa subsp. japonica MLO1 protein (Q0DC45) spans amino acids 1-540 and is typically produced with an N-terminal His-tag through E. coli expression systems. Its amino acid sequence begins with MAGGRSGSRELPETPTWAVAVVCAVLVLVSVAMEH and continues through multiple transmembrane domains. The protein's structure includes several predicted membrane-spanning regions characteristic of MLO family proteins, which are critical for its localization and function in the plant cell membrane . When expressed recombinantly, the protein maintains >90% purity as determined by SDS-PAGE analysis .

How does MLO1 differ between rice subspecies and what are the implications?

Rice subspecies (japonica, indica) show significant differences in MLO1 structure and function, which may contribute to their different disease resistance profiles. Research comparing MLO homologs between rice subspecies reveals variations that correlate with differential responses to pathogens. These differences may explain why some subspecies demonstrate greater resistance to certain diseases . Additionally, studies on wild rice have identified that mutations in homologous MLO proteins can significantly affect reproductive success and seed viability, suggesting evolutionary adaptations specific to different rice subspecies and their native environments .

What are the optimal conditions for handling recombinant MLO1 protein?

For optimal handling of recombinant MLO1 protein:

  • Storage: Store lyophilized powder at -20°C to -80°C immediately upon receipt

  • Aliquoting: Divide into small working volumes to prevent repeated freeze-thaw cycles

  • Reconstitution:

    • Centrifuge vial briefly before opening

    • Reconstitute in deionized sterile water to 0.1-1.0 mg/mL

    • Add glycerol to 5-50% final concentration (50% recommended)

  • Working storage: Store working aliquots at 4°C for maximum one week

  • Long-term storage: Keep at -20°C to -80°C

  • Avoid repeated freeze-thaw cycles which significantly reduce protein activity

The protein is typically supplied in Tris/PBS-based buffer with 6% Trehalose at pH 8.0, which helps maintain stability during storage .

What expression systems are most effective for producing functional MLO1 protein?

E. coli remains the predominant expression system for recombinant MLO1 protein production due to its efficiency and cost-effectiveness. When expressing MLO1, researchers should consider:

  • Optimization of codon usage for E. coli to enhance translation efficiency

  • Selection of appropriate fusion tags (His-tag being common) to facilitate purification

  • Growth conditions optimization (temperature, induction timing, media composition)

  • Proper solubilization methods for this transmembrane protein

  • Purification protocols that preserve protein conformation and function

While E. coli is widely used, some research applications requiring post-translational modifications may benefit from eukaryotic expression systems (yeast, insect cells) that better mimic the native plant cellular environment . When evaluating expression system efficiency, SDS-PAGE analysis should be employed to confirm protein purity of >90% .

How can MLO1 be used to investigate meiotic recombination mechanisms in rice?

MLO1 bears significant homology to MutL-homolog 1 (MLH1), which plays critical roles in meiotic recombination. Researchers can utilize recombinant MLO1/MLH1 to:

  • Study protein-protein interactions during meiotic crossover formation through:

    • Yeast two-hybrid assays to identify interacting partners

    • Bimolecular fluorescence complementation (BiFC) to visualize interactions in vivo

    • Co-immunoprecipitation using anti-His antibodies against recombinant His-tagged MLO1

  • Investigate differences in crossover rates between indica and japonica rice varieties

    • Japonica mutants show more severe fertility reduction and lower percentage of meiocytes with 12 bivalents compared to indica mutants

    • This suggests indica might maintain more residual crossovers than japonica when class I crossovers are disrupted

  • Examine fertility phenotypes through complementation studies using recombinant MLO1 in MLH1-mutant backgrounds

This research direction has revealed that indica rice may have inherently higher crossover rates than japonica varieties, with significant implications for rice breeding programs .

What methods are most effective for studying MLO1's role in rice disease resistance?

To investigate MLO1's function in disease resistance, researchers should consider:

  • CRISPR-Cas9 gene editing approaches to generate MLO1 knockout or mutant rice lines

  • Protein-pathogen interaction assays using recombinant MLO1 and pathogen effectors

  • Transgenic complementation studies with:

    • Wild-type MLO1

    • Site-directed mutants of specific MLO1 domains

    • MLO1 variants from different rice subspecies

  • Comparative transcriptomic analysis of MLO1 expression across:

    • Different developmental stages

    • Various pathogen challenges

    • Multiple rice varieties/subspecies

  • Subcellular localization studies using fluorescently tagged MLO1 to determine membrane positioning during infection

These methods can reveal mechanisms underlying MLO1's contribution to pathogen susceptibility or resistance, informing breeding strategies for disease-resistant rice varieties .

How do O. glaberrima and O. sativa MLO proteins differ in structure and function?

Research comparing African rice (O. glaberrima) and Asian rice (O. sativa) MLO proteins reveals:

  • Structural differences:

    • Sequence variations in key functional domains

    • Different patterns of post-translational modifications

    • Varied membrane topology potentially affecting protein-protein interactions

  • Functional differences:

    • O. glaberrima MLO proteins may contribute to its superior vegetative vigor and weed suppression abilities

    • O. glaberrima varieties generally show earlier flowering compared to O. sativa varieties

    • Different MLO protein variants correlate with varying degrees of pathogen resistance

These differences likely contribute to O. glaberrima's reported robustness and adaptability to sub-optimal African agricultural conditions. O. glaberrima varieties typically show shorter vegetative cycles, making them valuable for addressing pre-harvest food security challenges in affected regions .

What are the recommended approaches for studying MLO1 genetic variation across rice populations?

When investigating MLO1 genetic diversity:

  • Sampling strategy:

    • Include diverse rice accessions (wild relatives, landraces, modern cultivars)

    • Sample across geographical regions to capture environmental adaptations

    • Consider both indica and japonica subspecies for comparison

  • Sequencing approaches:

    • Targeted sequencing of MLO1 locus and regulatory regions

    • Whole-genome sequencing for broader genetic context

    • RNA-seq to identify expression variants

  • Phenotypic analysis:

    • Assess disease resistance profiles

    • Evaluate fertility and seed set percentage

    • Measure growth characteristics and stress responses

  • Data analysis:

    • Population structure analysis to identify MLO1 haplotypes

    • Selection signature detection to identify adaptive variants

    • Association studies linking MLO1 variants to phenotypic traits

This comprehensive approach can identify naturally occurring MLO1 variants with potentially beneficial traits for rice improvement programs .

What controls should be included when studying recombinant MLO1 protein function?

Robust experimental design for MLO1 functional studies should include:

  • Protein controls:

    • Empty vector controls processed identically to MLO1-expressing constructs

    • Denatured MLO1 protein to distinguish specific from non-specific effects

    • Related but functionally distinct MLO family proteins

  • Genetic controls:

    • Wild-type background matching the mutation background

    • Heterozygous MLO1 mutants to evaluate dosage effects

    • Complemented MLO1 mutants to confirm phenotype rescue

  • Experimental condition controls:

    • Multiple environmental conditions to test context-dependence

    • Various developmental timepoints to capture temporal effects

    • Different tissue types to assess tissue-specific functions

  • Technical controls:

    • Multiple independent protein preparations to account for batch effects

    • Range of protein concentrations to establish dose-response relationships

    • Alternative tags (beyond His-tag) to verify tag effects on protein function

These controls help distinguish genuine MLO1-specific functions from artifacts or generalized effects .

How should researchers address the challenge of working with transmembrane proteins like MLO1?

Transmembrane proteins present unique challenges requiring specialized approaches:

  • Solubilization strategies:

    • Optimize detergent selection (mild non-ionic detergents like DDM or Triton X-100)

    • Consider native membrane mimetics (nanodiscs, liposomes)

    • Test detergent-to-protein ratios systematically

  • Structural integrity verification:

    • Circular dichroism to assess secondary structure

    • Limited proteolysis to evaluate folding quality

    • Thermal shift assays to determine stability

  • Functional assays:

    • Reconstitution into artificial membrane systems

    • Binding assays with known interactors

    • Activity assays relevant to MLO1 function

  • Storage considerations:

    • Add stabilizing agents (glycerol, trehalose)

    • Maintain consistent pH and ionic conditions

    • Store at optimal temperature (-20°C to -80°C long-term, 4°C short-term)

Researchers should reconstitute lyophilized MLO1 carefully, following recommended protocols to maintain its native conformation and avoid protein aggregation or denaturation .

How can researchers effectively analyze the relationship between MLO1 variants and phenotypic traits?

To establish meaningful connections between MLO1 variants and rice phenotypes:

  • Statistical approaches:

    • ANOVA to detect significant differences between variant groups

    • Regression models to quantify relationships between MLO1 sequence and phenotype

    • Heritability estimations to determine genetic contribution to trait variation

  • Phenotyping methods:

    • Standardized protocols for measuring yield components (panicle length, weight, grain count)

    • Consistent scoring systems for disease resistance

    • High-throughput phenotyping for growth-related traits

  • Data integration:

    • Combine genotypic, transcriptomic, and phenotypic datasets

    • Perform pathway analysis to understand broader biological context

    • Utilize comparative genomics across rice subspecies

  • Validation strategies:

    • Test discovered associations in independent populations

    • Perform functional validation through transgenic approaches

    • Conduct field trials in multiple environments

This multi-faceted approach can reveal how MLO1 variants contribute to important agricultural traits and identify valuable genetic resources for breeding programs .

What are the key considerations when interpreting contradictory data on MLO1 function?

When faced with conflicting research findings:

  • Methodological differences:

    • Examine protein preparation methods (expression system, purification approach)

    • Compare experimental conditions (buffer composition, temperature, pH)

    • Assess protein quality metrics between studies

  • Genetic background effects:

    • Consider differences between indica vs. japonica backgrounds

    • Evaluate potential epistatic interactions with other genes

    • Examine environmental adaptations of source germplasm

  • Technical considerations:

    • Determine assay sensitivity and specificity limits

    • Evaluate statistical power of compared studies

    • Assess reproducibility across laboratories

  • Biological complexity:

    • Consider developmental timing of experiments

    • Examine tissue-specific effects that may explain discrepancies

    • Evaluate potential functional redundancy with other MLO family members

Researchers should systematically address these factors before concluding genuine contradictions exist in MLO1 literature .

What emerging technologies show promise for advancing MLO1 research?

Several cutting-edge approaches could accelerate MLO1 functional understanding:

  • Advanced structural biology:

    • Cryo-electron microscopy for membrane-embedded MLO1 visualization

    • AlphaFold2 and related computational tools for structure prediction

    • Hydrogen-deuterium exchange mass spectrometry for conformational dynamics

  • Genome editing advances:

    • Base editing for precise MLO1 variant creation

    • Prime editing for specific nucleotide substitutions

    • Multiplexed CRISPR systems for studying MLO family member interactions

  • Single-cell technologies:

    • Single-cell RNA-seq to detect cell-specific MLO1 expression

    • Spatial transcriptomics to map MLO1 expression in plant tissues

    • Single-cell proteomics to quantify MLO1 protein levels at cellular resolution

  • Field-based phenotyping:

    • Drone-based imaging of MLO1 variant field trials

    • IoT sensors for continuous monitoring of plant performance

    • Machine learning algorithms for phenotypic data integration

These technologies promise to bridge current knowledge gaps and accelerate translation of MLO1 research into agricultural applications .

How might research on MLO1 contribute to sustainable rice improvement strategies?

MLO1 research holds significant promise for addressing agricultural challenges:

  • Disease resistance improvement:

    • Identification of naturally occurring MLO1 variants conferring broad-spectrum resistance

    • Development of genetic markers for marker-assisted selection

    • Creation of novel resistance alleles through precision breeding

  • Climate resilience:

    • Understanding MLO1's role in stress responses

    • Identifying variants adapted to extreme environments

    • Developing rice lines with improved performance under climate change scenarios

  • Yield stability:

    • Exploiting MLO1's influence on reproductive development

    • Selecting variants with optimal meiotic recombination rates

    • Developing varieties with improved seed set under variable conditions

  • Genetic resource conservation:

    • Documenting MLO1 diversity in wild and landrace germplasm

    • Preserving valuable natural variants before potential loss

    • Creating a systematic catalog of functionally characterized MLO1 alleles

These applications demonstrate how fundamental MLO1 research can contribute to addressing global food security challenges while conserving genetic diversity .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.