Recombinant Oryza sativa subsp. japonica Oleosin 16 kDa (OLE16)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, but this can be adjusted to your preference.
Shelf Life
Shelf life depends on storage conditions, buffer components, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. To request a specific tag, please inform us, and we will prioritize its implementation.
Synonyms
OLE16; 1CP; OSE375; Os04g0546500; LOC_Os04g46200; OsJ_15670; OSJNBa0079A21.14; Oleosin 16 kDa; OSE701
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
2-148
Protein Length
Full Length of Mature Protein
Species
Oryza sativa subsp. japonica (Rice)
Target Names
OLE16
Target Protein Sequence
ADQHRGVIGGGGYGDRGGQEQQEKQRFMMTALKTVTAATAGGSMLVLSGLILAGTVIALT VATPVLVIFSPVLVPAAIALALMAAGFVTSGGLGVAALSVFSWMYKYLTGKHPPGADQLD HAKARLASKARDIKEAAQHRIDQAQAS
Uniprot No.

Target Background

Function

Oleosin 16 kDa (OLE16) may play a structural role in stabilizing lipid bodies during seed desiccation, preventing oil coalescence. It likely interacts with both lipid and phospholipid components of lipid bodies. Furthermore, it may provide recognition signals for specific lipases, facilitating lipolysis during seedling growth.

Database Links
Protein Families
Oleosin family
Subcellular Location
Lipid droplet. Membrane; Multi-pass membrane protein. Note=Surface of oil bodies. Oleosins exist at a monolayer lipid/water interface.

Q&A

What is the molecular structure and function of Oryza sativa OLE16?

OLE16 is a low molecular weight oleosin (16 kDa) that consists of three characteristic domains: a hydrophilic N-terminal domain, a central hydrophobic domain containing a conserved proline knot motif, and a hydrophilic C-terminal domain. The hydrophobic domain anchors the protein into the phospholipid monolayer of oil bodies, while the hydrophilic domains extend into the cytosol.

Functionally, OLE16 serves multiple purposes:

  • Prevents oil body coalescence through steric hindrance and surface charge effects

  • Maintains appropriate oil body size and stability during seed maturation and storage

  • May possess enzymatic activities similar to other oleosins, which have demonstrated monoacylglycerol acyltransferase and phospholipase A2 activities

  • Facilitates controlled mobilization of lipid reserves during germination

How does OLE16 expression affect oil body morphology?

OLE16 expression levels directly impact oil body size and stability. Research with other oleosin proteins has demonstrated:

  • Oleosin suppression results in abnormally large oil bodies in Arabidopsis seeds

  • Proper oleosin levels maintain uniformly sized oil bodies and prevent their coalescence

  • The ratio of oleosin to oil content is critical for maintaining structural integrity of oil bodies

  • Reintroduction of recombinant oleosins (like maize OLE16) can reverse aberrant phenotypes caused by oleosin deficiency

This suggests that rice OLE16 likely plays a similar role in maintaining appropriate oil body morphology and preventing coalescence of storage lipids in rice seeds.

What expression systems are optimal for producing recombinant rice OLE16?

Several expression systems can be utilized for recombinant OLE16 production, each with distinct advantages:

Expression SystemAdvantagesLimitationsBest Applications
E. coliHigh yield, economical, rapidMay form inclusion bodies, lacks PTMsStructural studies, antibody production
Yeast (S. cerevisiae)Eukaryotic PTMs, proper foldingLower yield than bacteriaFunctional studies, enzymatic assays
Plant systemsNative-like processing, correct targetingTime-consuming, lower yieldsIn vivo functional studies, complementation assays
Insect cellsHigh expression, proper foldingComplex media, higher costStructural biology, interaction studies

For functional studies, plant expression systems using seed-specific promoters like the linin promoter have proven effective for oleosin expression, as demonstrated with maize OLE16 in Arabidopsis .

What purification strategies yield the highest purity and activity for recombinant OLE16?

Purification of recombinant OLE16 requires specialized approaches due to its hydrophobic nature:

Primary Extraction Methods:

  • From seed tissues:

    • Isolate intact oil bodies via flotation centrifugation in sucrose gradients

    • Extract proteins using detergent solubilization (8 M urea with 10 mM CHAPS has been effective for oleosin purification)

  • From recombinant systems:

    • For bacterial inclusion bodies: Solubilize with 8 M urea or 6 M guanidine-HCl, followed by refolding

    • For membrane-associated forms: Extract with mild detergents (CHAPS, DDM, or Triton X-100)

Chromatographic Purification:

  • Affinity chromatography using His-tag or other fusion tags

  • Size exclusion chromatography to separate monomeric protein from aggregates

  • Ion exchange chromatography as a polishing step

Activity Preservation:

  • Maintain detergent concentrations above CMC throughout purification

  • Include phospholipids in buffers to stabilize the hydrophobic domain

  • Consider on-column refolding for proteins expressed in inclusion bodies

How can I verify the correct folding and functionality of purified recombinant OLE16?

Multiple complementary approaches should be used to verify proper folding and functionality:

Structural Verification:

  • Circular dichroism spectroscopy to assess secondary structure

  • Limited proteolysis to probe accessible cleavage sites

  • Thermal shift assays to evaluate protein stability

Functional Verification:

  • Oil body association assay:

    • Mix purified OLE16 with artificial oil bodies

    • Visualize association via immunofluorescence or electron microscopy

    • Quantify binding affinity and saturation

  • Complementation studies:

    • Express rice OLE16 in oleosin-deficient plants (e.g., OLEO1-suppressed Arabidopsis)

    • Assess reversal of abnormal phenotypes (oil body size, germination timing)

    • This approach has been successful with maize OLE16 in Arabidopsis

  • Enzymatic activity assays:

    • Test for monoacylglycerol acyltransferase activity (if present in rice OLE16)

    • Measure phospholipase activity using fluorogenic substrates

    • Compare kinetic parameters with those of characterized oleosins

How does rice OLE16 contribute to seed germination?

OLE16 plays critical roles during seed germination through multiple mechanisms:

  • Controlled lipid mobilization:

    • Regulates access of lipases to oil body triacylglycerols

    • Prevents uncontrolled lipolysis that could cause lipotoxicity

    • Studies in Arabidopsis showed that oleosin suppression caused delayed germination

  • Oil body integrity maintenance:

    • Prevents premature coalescence during early germination

    • Maintains appropriate surface-to-volume ratio for efficient lipase action

    • Coordinates with other oil body proteins to regulate breakdown timing

  • Signaling roles:

    • May function in hormone-responsive pathways during germination

    • Could interact with proteins involved in seedling establishment

Experimental data from Arabidopsis demonstrates that proper oleosin levels are essential for normal germination timing, and that aberrant phenotypes caused by oleosin deficiency can be reversed by introducing recombinant oleosins .

What techniques are effective for studying OLE16 interactions with other proteins?

Understanding OLE16's protein interaction network requires specialized approaches:

In vitro techniques:

  • Pull-down assays:

    • Immobilize tagged OLE16 on affinity resin

    • Incubate with seed extracts or candidate proteins

    • Identify binding partners via mass spectrometry

  • Surface plasmon resonance:

    • Measure real-time binding kinetics

    • Determine affinity constants for specific interactions

    • Assess effects of mutations or conditions on binding

In vivo techniques:

  • Bimolecular fluorescence complementation (BiFC):

    • Express OLE16 and candidate interactors as split-fluorescent protein fusions

    • Visualize interactions in plant cells via fluorescence microscopy

    • Determine subcellular localization of interactions

  • Proximity labeling:

    • Fuse OLE16 to enzymes like BioID or APEX2

    • Label proximal proteins in living cells

    • Identify by streptavidin pull-down and mass spectrometry

  • Co-immunoprecipitation from oil bodies:

    • Isolate intact oil bodies from transgenic plants

    • Perform immunoprecipitation with anti-OLE16 antibodies

    • Identify co-precipitated proteins by mass spectrometry

These approaches have revealed that oil bodies contain multiple protein components including different oleosin isoforms that together form functional complexes .

How can OLE16 be utilized for heterologous protein expression and purification?

OLE16 has significant potential as a fusion partner for recombinant protein production:

Mechanisms and advantages:

  • Oil body targeting:

    • OLE16 fusion proteins localize to oil bodies when expressed in plants

    • Enables simple purification via flotation centrifugation

    • Similar oleosin fusions have demonstrated correct targeting across species boundaries

  • Expression enhancement:

    • Can improve expression levels of partner proteins

    • May enhance stability through membrane association

    • Provides spatial separation from proteases

Methodological approach:

  • Create fusion constructs with OLE16 at N- or C-terminus

  • Include flexible linker and protease cleavage site

  • Express in seed tissues under strong seed-specific promoters (e.g., linin promoter)

  • Harvest seeds and isolate oil bodies via flotation centrifugation

  • Release target protein by protease cleavage

Applications:

  • Production of industrial enzymes

  • Biopharmaceutical protein expression

  • Metabolic engineering of oil bodies

How does rice OLE16 compare functionally to oleosins from other plant species?

Functional comparison reveals both conserved and species-specific aspects:

Conserved functions:

  • Oil body stabilization and size regulation

  • Prevention of oil body coalescence during seed maturation and germination

  • Correct targeting to oil bodies even in heterologous systems

Species-specific adaptations:

  • Variations in expression patterns and developmental timing

  • Differences in thermal stability reflecting adaptation to germination conditions

  • Potential variations in enzymatic activities

Cross-species complementation:
Maize OLE16 can functionally complement Arabidopsis oleosin deficiency despite phylogenetic distance, suggesting conservation of core functions . This indicates rice OLE16 likely shares fundamental functional properties with oleosins from other species.

What are the effects of OLE16 overexpression on oil accumulation in seeds?

Oleosin overexpression impacts both oil body morphology and oil accumulation:

Effects on oil body morphology:

  • Decreased oil body size due to increased surface-to-volume ratio

  • More uniform size distribution

  • Increased oil body number per cell

Effects on oil content:

  • Studies in other plants indicate that oleosin overexpression can increase total oil content

  • In anise (Pimpinella anisum) cell cultures, oleosin overexpression resulted in higher oil content

  • Seeds with high oil content naturally accumulate more oleosin than those with low oil content

Proposed mechanism:
Increased oleosin levels prevent oil body coalescence, creating more smaller oil bodies with greater total surface area. This may enhance the capacity for TAG synthesis by providing more interfaces for the action of lipid biosynthetic enzymes.

What molecular techniques are most effective for studying OLE16 function in vivo?

Several complementary approaches provide insights into OLE16 function:

Genetic manipulation techniques:

  • RNAi knockdown:

    • Construct RNAi vectors targeting OLE16 (antisense, hairpin, or loop configurations)

    • Transform plants via Agrobacterium-mediated methods

    • Select lines with varying degrees of suppression

    • This approach has been effective for studying oleosin function in Arabidopsis

  • CRISPR/Cas9 gene editing:

    • Design sgRNAs targeting OLE16 coding sequence

    • Create knockout or precise point mutations

    • Analyze effects on oil body morphology and seed development

  • Complementation studies:

    • Express rice OLE16 in oleosin-deficient backgrounds

    • Assess reversal of phenotypes

    • Compare with complementation by oleosins from other species

Visualization techniques:

  • Advanced microscopy:

    • Confocal microscopy with oil-specific dyes (Nile Red, BODIPY)

    • Electron microscopy for ultrastructural analysis

    • Super-resolution microscopy for protein organization on oil bodies

  • In vivo protein tracking:

    • Fluorescent protein fusions to study OLE16 trafficking

    • Photoactivatable tags for dynamic studies during germination

    • FRAP analysis to assess protein mobility on oil body surfaces

These approaches have revealed that oleosin suppression causes dramatic changes in oil body size and organization, and that these phenotypes can be reversed by expressing recombinant oleosins .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.