Recombinant Oryza sativa subsp. japonica Oleosin 18 kDa (OLE18)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a reference.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
OLE18; Os03g0699000; LOC_Os03g49190; OsJ_011734; OSJNBb0017F17.17; Oleosin 18 kDa; OSE721
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
2-172
Protein Length
Full Length of Mature Protein
Species
Oryza sativa subsp. japonica (Rice)
Target Names
OLE18
Target Protein Sequence
ADRDRAGQYYQQQRGQVGETVKGILPEKAPSASQALTVATLFPLGGLLLVLSGLALAASV VGLAVATPVFLIFSPVLVPAALLIGLAVAGFLTSGALGLGGLSSLTFLANTARQAFQRTP DYVEQARRRMAEAAAHAGHKTAQAGHAIQGRADQAGTGAGAGGGAGTKTSS
Uniprot No.

Target Background

Function
This protein may play a structural role in stabilizing lipid bodies during seed desiccation by preventing oil coalescence. It likely interacts with both lipid and phospholipid components of lipid bodies. It may also provide recognition signals for specific lipase binding during lipolysis in seedling growth.
Gene References Into Functions
  1. Oleosin is present in both the embryo and aleurone layer, while caleosin is found only in the embryo. PMID: 22892331
Database Links
Protein Families
Oleosin family
Subcellular Location
Lipid droplet. Membrane; Multi-pass membrane protein. Note=Surface of oil bodies. Oleosins exist at a monolayer lipid/water interface.

Q&A

What is Oleosin 18 kDa (OLE18) and where is it localized in rice tissues?

Oleosin 18 kDa (OLE18) is a hydrophobic protein found in rice (Oryza sativa subsp. japonica) that localizes to the surface of oil bodies in seeds. It is one of two main oleosin isoforms (18 kDa and 16 kDa) present in rice, with both found in similar ratios in rice embryos and aleurone layers . The gene encoding OLE18 is identified as Os03g0699000 or LOC_Os03g49190, with alternative designations including OSE721 . OLE18 serves as a structural component that stabilizes oil bodies, which are specialized organelles that store lipids in plant seeds.

The protein's expression is temporally regulated, with mRNA appearing approximately seven days after pollination and diminishing in mature seeds, coinciding with the period of active oil body formation .

How can OLE18 be utilized as a fusion partner for recombinant protein production?

OLE18 has proven effective as a carrier protein for biologically active peptides in rice seeds. The methodology involves:

  • Creating a fusion construct where the target protein/peptide is genetically linked to OLE18

  • Including a protease recognition site (e.g., TEV protease site) between OLE18 and the target

  • Expressing this fusion under control of the OLE18 promoter

  • Targeting the fusion to oil bodies in rice seeds

  • Purifying via simple homogenization and flotation centrifugation methods

This system has been successfully demonstrated with cecropin A (CecA), an antimicrobial peptide. The OLE18-CecA fusion accumulated in rice oil bodies without negative effects on seed viability, seedling growth, or yield, making it an elegant platform for bioactive peptide production .

Key advantages include compartmentalization of the recombinant protein in oil bodies, simplified downstream processing, and the potential for high yield in a food-grade expression system.

What is the relationship between OLE18 expression and triacylglycerol accumulation during seed development?

Studies reveal a precisely coordinated relationship between OLE18 expression and lipid accumulation in developing rice seeds. Triacylglycerols and oleosins accumulate concomitantly during seed maturation, aligning with the assembly of oil bodies .

OLE18 mRNA appears approximately seven days post-pollination and diminishes in mature seeds. This temporal expression profile precisely matches the period of oil body formation and lipid deposition in the developing seed .

Interestingly, post-germination analysis shows differential utilization of stored lipids depending on tissue location. While approximately 60% of stored triacylglycerols in rice remain unutilized after germination, the majority of oil bodies in embryos are mobilized within five days after imbibition, whereas those in aleurone layers remain largely intact in post-germinative seedlings . This suggests tissue-specific differences in lipid mobilization that may correlate with oleosin dynamics.

How does the structure of OLE18 contribute to oil body stability in seeds?

The tripartite domain structure of OLE18 is highly specialized for oil body stabilization:

  • The central hydrophobic hairpin domain anchors deeply into the triacylglycerol matrix of the oil body

  • The amphipathic C-terminal domain interacts with both the phospholipid monolayer and the aqueous cytoplasm

  • The hydrophilic N-terminal domain extends into the cytoplasm

This arrangement creates a steric hindrance that prevents oil bodies from coalescing, maintaining them as discrete organelles. While the central domain is essential for targeting and anchoring, the terminal domains can accommodate substantial amino acid substitutions without compromising functionality . This structural flexibility has been exploited in biotechnology applications where OLE18 serves as a fusion partner.

Comparative studies with other seed systems suggest that oleosins contribute significantly to colloidal stability. Research on soybean oil bodies demonstrates that oleosin-coated oil bodies exhibit higher stability and improved floating rates compared to those without intact oleosins .

What expression systems are suitable for producing recombinant OLE18 protein?

Multiple expression platforms have been successfully employed for recombinant OLE18 production:

Expression SystemCharacteristicsApplicationsReference
E. coli- N-terminal His-tagged fusion
- Expressed as full-length mature protein (2-172aa)
- Stored as lyophilized powder in Tris/PBS buffer with 6% trehalose
Biochemical studies, antibody production, structural analysis
Rice seeds- Native OLE18 promoter
- Targeted to oil bodies
- Co-expressed with fusion partners
Bioactive peptide production, protein purification via oil body isolation
Rice cell culture- Controlled bioreactor conditions
- Potential for upscaling
- Post-translational modifications preserved
Large-scale production, glycosylated protein variants

For E. coli-expressed recombinant OLE18, proper storage conditions are critical. The protein should be maintained at -20°C/-80°C, with aliquoting recommended to avoid repeated freeze-thaw cycles. Working aliquots can be stored at 4°C for up to one week. Reconstitution should be performed in deionized sterile water to 0.1-1.0 mg/mL, with 5-50% glycerol added for long-term storage .

What purification strategies are most effective for OLE18-fusion proteins from rice?

For OLE18-fusion proteins expressed in rice seeds, a simple yet effective purification protocol has been established:

  • Homogenization: Rice seeds containing the OLE18-fusion are homogenized to disrupt cellular structures while preserving oil body integrity

  • Flotation centrifugation: Exploiting the buoyancy of oil bodies, a simple centrifugation step causes oil bodies (with attached OLE18-fusion proteins) to float to the surface, facilitating separation from other cellular components

  • Protease cleavage: For fusion proteins containing a TEV protease recognition site, treatment with the enzyme releases the target protein from OLE18

  • Secondary purification: Optional additional chromatography steps may be employed depending on the required purity

This approach has been validated with OLE18-CecA fusion proteins, demonstrating that biologically active cecropin A can be efficiently purified from transgenic rice seeds with high yield and activity .

How can researchers effectively monitor OLE18 expression during seed development?

Several complementary techniques can be employed to monitor OLE18 expression throughout seed development:

  • Transcriptional analysis:

    • RT-PCR or qPCR to quantify OLE18 mRNA levels

    • RNA-Seq for global expression profiling

    • In situ hybridization for tissue-specific localization

  • Protein detection:

    • Western blotting with OLE18-specific antibodies

    • Proteomics analysis of developing seeds

    • In situ immunodetection to visualize tissue localization

  • Oil body isolation and characterization:

    • Isolation of oil bodies at different developmental stages

    • Protein composition analysis by SDS-PAGE

    • Microscopy to assess oil body morphology and abundance

Research has established that OLE18 mRNA appears seven days post-pollination and diminishes in mature seeds . This temporal expression pattern provides a framework for designing time-course experiments to monitor OLE18 dynamics during seed development.

What are optimal oil body extraction methods for OLE18 research?

Oil body extraction protocols should be tailored to the specific research objectives:

For biochemical characterization:

  • Homogenize seeds in buffer (typically containing sucrose and protease inhibitors)

  • Filter homogenate to remove large debris

  • Layer filtrate under buffer in centrifuge tube

  • Perform flotation centrifugation (typically 10,000×g for 30 minutes)

  • Collect floating oil body fraction

  • Wash oil bodies by repeating flotation centrifugation

For structural studies:
Additional steps may include:

  • Size fractionation using differential centrifugation

  • Density gradient separation for improved purity

  • Gentle washing procedures to maintain native protein-lipid interactions

For proteomics analysis:

  • Stringent washing of oil bodies to remove loosely associated proteins

  • Protein extraction using detergents or organic solvents

  • Proteomic analysis by mass spectrometry

Isolated oil bodies can be characterized by:

  • Particle size analysis

  • Transmission electron microscopy

  • Proteomics to identify associated proteins

  • Stability assessments through floating rate measurements

How can the OLE18 promoter be utilized in biotechnological applications?

The OLE18 promoter offers several advantageous features for biotechnology applications:

  • Tissue-specific expression: The promoter drives gene expression primarily in embryos and aleurone layers, with minimal activity in endosperm tissues

  • Developmental regulation: Expression is temporally controlled, with activity peaking during seed development and oil body formation

  • Implementation methodology:

    • Isolation of the OLE18 promoter (approximately 1139 bp plus 61 bp 5'-UTR) via PCR from genomic rice DNA

    • Integration into plant expression vectors upstream of the gene of interest

    • Transformation into rice through established methods (e.g., Agrobacterium-mediated or biolistic techniques)

Researchers should note that sequence variations exist between rice varieties (e.g., differences between indica and japonica cultivars), which may affect promoter functionality in different genetic backgrounds . When designing constructs with the OLE18 promoter, these potential sequence variations should be considered.

What analytical techniques are most informative for studying OLE18 structure-function relationships?

Multi-dimensional analytical approaches provide complementary insights into OLE18 structure-function relationships:

  • Structural analysis:

    • Circular dichroism (CD) spectroscopy to assess secondary structure elements

    • NMR spectroscopy for detailed structural analysis

    • Molecular dynamics simulations to predict domain interactions with lipid interfaces

  • Functional characterization:

    • Mutagenesis of specific domains to assess impact on oil body targeting

    • Truncation analysis to identify minimal functional regions

    • Fusion protein studies to evaluate domain tolerance for modifications

  • Interaction studies:

    • Liposome binding assays to characterize lipid interactions

    • Oil body reconstitution experiments

    • Cross-linking studies to identify protein-protein interactions

  • Biophysical characterization:

    • Surface tension measurements to assess interface stabilization

    • Differential scanning calorimetry to evaluate thermal stability

    • Atomic force microscopy to visualize protein organization at interfaces

These approaches can be combined to develop a comprehensive understanding of how OLE18's tripartite domain structure contributes to its function in stabilizing oil bodies and how this knowledge can be applied in biotechnological applications.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.