Recombinant Oryza sativa subsp. japonica Peroxisomal membrane protein 11-2 (PEX11-2)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for custom preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a reference.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and the protein's inherent stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type will be determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
PEX11-2; Os03g0301950; LOC_Os03g19000; Peroxisomal membrane protein 11-2; OsPEX11-2; OsPEX11-5; Peroxin-11-2
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-254
Protein Length
full length protein
Species
Oryza sativa subsp. japonica (Rice)
Target Names
PEX11-2
Target Protein Sequence
MVTAAGSPSSSSARKPASRPRLPCRDILVHIEAYLSRRDGVDNLLKVSLYAARLALALAA GQPPLPHAATARLRSFESSVGLSRKAFRLGKFVQSINALRAAAYHPHPHVHPLLVLLAYG GQGVYNFLEQFAWLAKAGLLPARLLPRRLHRIGVWAQLLAHVGSIAIKLEEVAELECGVE ARLEEGCGEESEVVRTLSRKLLLKLMSLVQDMVDSAMTVGDVTGRKGLLGSSTLMASAGL LSALISVHKNWNSC
Uniprot No.

Target Background

Function
Involved in peroxisomal proliferation.
Database Links
Protein Families
Peroxin-11 family
Subcellular Location
Peroxisome membrane; Multi-pass membrane protein.

Q&A

What is the basic structure and genomic organization of OsPEX11-2?

OsPEX11-2 (LOC_Os03g19000) is a peroxisomal membrane protein encoded by a gene located on chromosome 3 of rice. Unlike OsPEX11-1 and OsPEX11-5, which contain multiple introns (7 and 9 respectively), OsPEX11-2's coding sequence is not interrupted by any introns. The protein consists of 254 amino acids and contains conserved domains characteristic of the PEX11 family .

Genomically, OsPEX11-2 is positioned remarkably close to OsPEX11-3 (only 782 bp apart) on chromosome 3, suggesting these genes likely arose from a relatively recent duplication event. This proximity and sequence similarity support the hypothesis that they are paralogues .

What are the primary functions of PEX11-2 in rice cells?

OsPEX11-2, like other members of the PEX11 family, is involved in peroxisome biogenesis and proliferation. Peroxisomes are single membrane-bound organelles whose basic enzymatic constituents include catalase and H₂O₂-producing flavin oxidases .

PEX11 proteins in eukaryotes play critical roles in:

  • Regulating peroxisome abundance

  • Controlling peroxisome morphology and size

  • Facilitating peroxisome division

In rice, the specific functions of PEX11-2 appear to be highly specialized compared to other family members, as evidenced by its restricted expression pattern primarily in germinated seeds, suggesting a role in early seedling development .

How does OsPEX11-2 differ from PEX11 proteins in other model organisms?

OsPEX11-2 exhibits several distinct characteristics compared to PEX11 homologs in other organisms:

OrganismPEX11 Family SizeNotable Differences
Rice (O. sativa)5 members (OsPEX11-1 to -5)OsPEX11-2 has highly specific expression in germinated seeds; unresponsive to stress conditions
Arabidopsis5 members (PEX11a, b, c, d, e)All five promote peroxisome proliferation; PEX11c and PEX11e can complement yeast pex11 mutants
Yeast (S. cerevisiae)1 memberSingle PEX11 controls peroxisome proliferation during growth on oleic acid
Mammals3 members (PEX11α, β, γ)More complex regulation with tissue-specific expression patterns

Unlike Arabidopsis PEX11 proteins that are widely expressed and stress-responsive, OsPEX11-2 shows remarkable specialization in both expression pattern and apparent lack of stress responsiveness .

What is the expression profile of OsPEX11-2 during rice development?

OsPEX11-2 displays a highly restricted expression pattern compared to other rice PEX11 family members:

PEX11 GenePrimary Expression LocationsNotable Characteristics
OsPEX11-1Leaf tissues, seedling stage, flag leafHighest expression at flag leaf stage (5 days before heading)
OsPEX11-2Germinated seeds (72h after water imbibition)Much less or no expression in other tissues
OsPEX11-3Endosperm, germinated seeds, callus, young seedlingAlso expressed in vegetative tissues at late stages
OsPEX11-4Leaf tissuesSimilar pattern to OsPEX11-1
OsPEX11-5All tissues investigatedBroad expression pattern

This highly specific expression profile of OsPEX11-2 primarily in germinating seeds suggests a specialized role during early seedling development, potentially related to mobilization of seed storage compounds or establishment of functional peroxisomes during germination .

How is OsPEX11-2 expression affected by environmental stresses?

Unlike other members of the rice PEX11 family, OsPEX11-2 shows a remarkable lack of responsiveness to various environmental stresses:

PEX11 GeneResponse to ABAResponse to H₂O₂Response to SaltResponse to Low Nitrogen
OsPEX11-1InducedInducedInducedInduced
OsPEX11-2No responseNo responseNo responseNo response
OsPEX11-3ResponsiveResponsiveNot responsiveNot responsive
OsPEX11-4InducedInducedInducedInduced
OsPEX11-5ResponsiveResponsiveResponsiveNot responsive

This differential expression pattern under stress conditions highlights the functional diversification within the PEX11 family in rice. The lack of stress-responsive expression for OsPEX11-2 suggests it likely maintains constitutive functions related to peroxisome biogenesis during seed germination rather than adapting to environmental challenges .

What are the key transcriptional regulators controlling OsPEX11-2 expression?

While the search results don't specifically identify transcription factors regulating OsPEX11-2, its highly specific expression in germinating seeds suggests regulation by seed-specific transcription factors. Based on broader plant research, candidate regulatory mechanisms may include:

  • ABA-responsive elements (ABREs) and regulatory factors, which are abundant in seed-expressed genes

  • Seed-specific transcription factors such as FUSCA3, LEC1, or ABI3 homologs in rice

  • DOF-type zinc finger proteins known to regulate seed-specific gene expression

To identify specific transcriptional regulators, researchers should consider promoter analysis of the OsPEX11-2 gene to identify cis-regulatory elements, followed by yeast one-hybrid assays to identify interacting transcription factors .

What are the recommended protocols for expressing and purifying recombinant OsPEX11-2?

Based on established protocols for similar recombinant proteins, researchers should consider the following approaches for OsPEX11-2:

Expression Systems:
Different expression systems can be utilized depending on research needs:

  • E. coli: Suitable for basic structural studies, typically using pET series vectors

  • Yeast: Beneficial for functional studies, especially when testing complementation of pex11 mutants

  • Baculovirus/insect cells: For proteins requiring eukaryotic post-translational modifications

  • Mammalian cells: For highest fidelity to eukaryotic protein modifications

Purification Protocol:

  • Cell lysis: For membrane proteins like PEX11-2, use detergent-based lysis buffers (e.g., containing 1-2% Triton X-100 or n-dodecyl-β-D-maltoside)

  • Affinity chromatography: Using His-tag (e.g., MagneHis Protein Purification System) or GST-tag systems (e.g., MagneGST Pull Down System) as demonstrated for other rice proteins

  • Size-exclusion chromatography: To remove aggregates and ensure homogeneity

  • Reconstitution: In deionized sterile water to a concentration of 0.1-1.0 mg/mL with 5-50% glycerol for long-term storage at -20°C/-80°C

The choice between these expression systems should be guided by the specific experimental requirements, with E. coli offering simplicity and high yield, while eukaryotic systems provide more authentic post-translational modifications .

How can I verify the functionality of recombinant OsPEX11-2 protein?

Functional verification of recombinant OsPEX11-2 can be approached through multiple complementary methods:

In vitro assays:

  • Lipid binding assays: To test interaction with peroxisomal membrane lipids

  • Protein-protein interaction studies: Using pull-down assays with known peroxisomal proteins (as demonstrated with OsCYP2 interaction with OsPEX11)

  • Membrane insertion assays: Using artificial liposomes to test integration capacity

In vivo functional assays:

  • Complementation of yeast pex11 mutants: Although unlike OsPEX11c and OsPEX11e in Arabidopsis, plant PEX11-2 may not fully complement yeast mutants due to functional divergence

  • Transient expression in plant protoplasts: Visualizing localization to peroxisomes using fluorescent tags

  • Heterologous expression in Arabidopsis or rice pex11 mutant lines

Structural integrity verification:

  • Circular dichroism (CD) spectroscopy: To verify secondary structure

  • Limited proteolysis: To confirm proper folding

  • Size-exclusion chromatography with multi-angle light scattering (SEC-MALS): To verify oligomeric state

These methods provide complementary information about different aspects of PEX11-2 function and should be selected based on research objectives .

What are the critical considerations for designing experiments with recombinant OsPEX11-2?

When designing experiments with recombinant OsPEX11-2, researchers should consider:

Protein solubility and stability:

  • As a membrane protein, PEX11-2 requires appropriate detergents or lipid environments

  • Add 5-50% glycerol to storage buffers to maintain stability

  • Store at -20°C/-80°C and avoid repeated freeze-thaw cycles (≤3 recommended)

Expression system selection:

  • E. coli: Quick and high-yield but may lack proper folding for membrane proteins

  • Yeast: Better for functional studies, especially when testing complementation

  • Mammalian/insect cells: Superior for post-translational modifications and proper folding

Tag placement considerations:

  • N-terminal tags may interfere with membrane insertion

  • C-terminal tags may affect peroxisome targeting

  • Tag type will affect purification strategy and downstream applications

Functional assay design:

  • Include appropriate positive controls (other verified PEX11 proteins)

  • Design negative controls lacking key functional domains

  • Consider the potential need for rice-specific interaction partners absent in heterologous systems

Addressing these considerations will significantly improve experimental outcomes when working with this challenging membrane protein .

How does OsPEX11-2 contribute to peroxisome biogenesis and proliferation in rice?

While search results don't detail the specific mechanism for OsPEX11-2, we can infer from related research that:

PEX11-2, like other PEX11 family members, likely promotes peroxisome proliferation through membrane remodeling. In Arabidopsis, when PEX11 proteins are overexpressed, they induce peroxisome proliferation, whereas reduced expression decreases peroxisome abundance . The mechanistic steps likely involve:

  • Membrane elongation: PEX11-2 may induce tubulation of the peroxisomal membrane

  • Constriction: Recruitment of fission machinery (likely DRP proteins in plants)

  • Scission: Completion of the division process

OsPEX11-2's specific expression in germinating seeds suggests a specialized role in establishing the peroxisome population during early seedling development, particularly during the transition from heterotrophic to autotrophic growth when glyoxylate cycle activity is high .

To definitively determine OsPEX11-2's role, researchers should consider:

  • Live-cell imaging of fluorescently-tagged PEX11-2 during peroxisome division

  • Electron microscopy to visualize ultrastructural changes

  • Quantitative analysis of peroxisome morphology in OsPEX11-2 overexpression and knockdown lines

What role does OsPEX11-2 play in rice stress responses compared to other PEX11 family members?

Unlike other members of the PEX11 family in rice, OsPEX11-2 appears to have minimal involvement in stress responses:

PEX11 MemberSalt Stress ResponseOxidative Stress ResponseABA Response
OsPEX11-1Strongly inducedStrongly inducedInduced
OsPEX11-2No responseNo responseNo response
OsPEX11-3Low/no responseResponsiveResponsive
OsPEX11-5ResponsiveResponsiveResponsive

OsPEX11 (not specifically PEX11-2) overexpression improves salt tolerance by:

  • Decreasing Na⁺/K⁺ ratio through regulation of cation transporters (OsHKT2;1, OsHKT1;5, OsLti6a, OsLti6b, OsSOS1, OsNHX1, and OsAKT1)

  • Enhancing antioxidant enzyme activities (SOD, POD, CAT)

  • Increasing proline accumulation

  • Reducing lipid peroxidation

How does OsPEX11-2 interact with other peroxisomal and cellular proteins?

While specific OsPEX11-2 protein interactions aren't detailed in the search results, broader findings on PEX11 proteins suggest potential interaction partners:

Confirmed interaction partner for OsPEX11:

  • OsCYP2: A cyclophilin protein that directly interacts with OsPEX11 as demonstrated by yeast two-hybrid and GST pull-down assays

Potential interaction partners based on function:

  • Fission machinery components: Likely dynamin-related proteins (DRPs) that execute membrane scission

  • Peroxisomal membrane proteins: Other PEX proteins involved in matrix protein import (PEX3, PEX19)

  • Cytoskeletal components: For peroxisome positioning and movement

Experimental approaches to identify interactions:

  • Yeast two-hybrid screening using OsPEX11-2 as bait

  • Co-immunoprecipitation followed by mass spectrometry

  • Bimolecular fluorescence complementation (BiFC) in planta

  • Proximity labeling methods (BioID or APEX) to identify proximal proteins in the native environment

These interaction studies would provide valuable insights into the mechanistic role of OsPEX11-2 in germinating rice seeds and potentially reveal novel peroxisome biogenesis pathways specific to monocot plants .

How is OsPEX11-2 evolutionarily related to other PEX11 proteins in plants and other organisms?

Phylogenetic analysis reveals that PEX11 sequences from rice and other species can be classified into three major evolutionary groups:

Evolutionary relationships:

  • OsPEX11-2 and OsPEX11-3 are most closely related and likely resulted from a relatively recent duplication event, as evidenced by their close proximity on chromosome 3 (only 782 bp apart)

  • The five rice PEX11 members show greater sequence similarity to their respective orthologs in other monocots than to each other, suggesting the PEX11 gene family diversified before monocot-dicot divergence

  • Comparative analysis of Ka/Ks ratios suggests purifying selection operating on PEX11 genes, indicating functional constraint despite sequence divergence

Structural conservation:

  • All PEX11 family members contain conserved domains for membrane association and peroxisome proliferation

  • Despite sequence divergence, secondary structure prediction suggests conservation of key structural elements across evolutionary diverse PEX11 proteins

This evolutionary analysis highlights that while PEX11 genes maintain core functions in peroxisome proliferation, individual family members like OsPEX11-2 have evolved specialized functions, as evidenced by its highly specific expression pattern and lack of stress responsiveness .

What are the key functional differences between OsPEX11-2 and other rice PEX11 family members?

The five rice PEX11 proteins exhibit significant functional diversification:

PEX11 MemberExpression PatternStress ResponsivenessFunctional Implications
OsPEX11-1High in leaf tissuesInduced by ABA, H₂O₂, salt, low nitrogenLikely involved in photosynthetic tissue responses to stress
OsPEX11-2Exclusively in germinated seedsNo response to stressesSpecialized role in seed germination; possibly glyoxylate cycle/β-oxidation
OsPEX11-3Endosperm, germinated seeds, vegetative tissuesResponsive to ABA, H₂O₂Broader role spanning seed development and stress responses
OsPEX11-4Higher in leaf tissuesInduced by ABA, H₂O₂, salt, low nitrogenSimilar to OsPEX11-1, likely photosynthetic tissue functions
OsPEX11-5All tissues investigatedResponsive to ABA, H₂O₂, saltGeneral housekeeping role in peroxisome maintenance

OsPEX11-2 stands out with its highly specialized expression pattern and lack of stress inducibility, suggesting a dedicated role in establishing the peroxisome population during seed germination. This specialization likely relates to the high demand for β-oxidation and glyoxylate cycle activities during the mobilization of seed storage lipids, a process critical for early seedling establishment .

These functional differences underscore the evolutionary diversification within the PEX11 family, with individual members assuming specific roles in different tissues and developmental stages .

How does the subcellular localization and membrane topology of OsPEX11-2 compare with other PEX11 proteins?

While the search results don't provide specific details on OsPEX11-2 topology, we can infer from studies on other PEX11 proteins:

Expected subcellular localization:

  • Like all PEX11 family members, OsPEX11-2 is expected to localize to the peroxisomal membrane

  • This localization can be visualized using fluorescent fusion proteins (CFP/YFP/GFP-PEX11-2) in plant cells

Predicted membrane topology:

  • Based on Arabidopsis PEX11 proteins, OsPEX11-2 likely contains:

    • Two transmembrane domains

    • N- and C-termini facing the cytosol

    • A short intra-peroxisomal loop

  • This topology allows interaction with both cytosolic factors and peroxisomal matrix proteins

Experimental verification methods:

  • Fluorescent protein tagging at N- or C-terminus to confirm peroxisomal membrane localization

  • Protease protection assays to determine topology

  • Split-GFP complementation to identify cytosol-facing domains

  • Immunogold electron microscopy for high-resolution localization

The peroxisomal membrane location is critical for PEX11-2 function in membrane remodeling during peroxisome proliferation, particularly during the establishment of functional peroxisomes in germinating seeds .

What are the most promising applications of recombinant OsPEX11-2 in agricultural biotechnology?

Based on current understanding of PEX11 functions, several promising applications of OsPEX11-2 in agricultural biotechnology can be envisioned:

Improving germination efficiency and seedling establishment:

  • Given OsPEX11-2's specific expression in germinating seeds, its manipulation could enhance early seedling vigor

  • Overexpression might accelerate mobilization of seed storage reserves via enhanced peroxisome function

  • This could be particularly valuable for direct-seeded rice cultivation systems

Enhancing metabolic efficiency:

  • Optimizing peroxisome numbers could improve β-oxidation and photorespiration efficiency

  • This might lead to enhanced energy utilization during critical developmental transitions

Potential biotechnology strategies:

  • Promoter modifications to optimize expression timing during germination

  • Protein engineering to enhance membrane remodeling efficiency

  • Cross-species expression of optimized PEX11-2 variants

What methodological advances would facilitate better understanding of OsPEX11-2 structure-function relationships?

Several methodological advances would significantly enhance our understanding of OsPEX11-2:

Structural biology approaches:

  • Cryo-electron microscopy of membrane-embedded PEX11-2: Would provide atomic-level insights into membrane deformation mechanisms

  • X-ray crystallography of soluble domains: Could reveal interaction interfaces

  • NMR studies of specific domains: Would provide dynamic information about conformational changes

Advanced imaging techniques:

  • Super-resolution microscopy (PALM/STORM): To visualize PEX11-2 distribution on peroxisome membranes at nanoscale resolution

  • Live-cell imaging with photoactivatable fluorescent proteins: To track PEX11-2 dynamics during peroxisome proliferation

  • Correlative light and electron microscopy (CLEM): To connect molecular localization with ultrastructural changes

Functional genomics approaches:

  • CRISPR/Cas9 genome editing: For precise modification of endogenous OsPEX11-2

  • Conditional expression systems: To control OsPEX11-2 activity with temporal precision

  • Proximity labeling methods (TurboID, APEX): To identify the OsPEX11-2 interactome in vivo

Computational approaches:

  • Molecular dynamics simulations: To model membrane interactions

  • Protein-protein docking: To predict interaction partners

  • Machine learning approaches: To identify functional motifs

These methodological advances would provide unprecedented insights into how OsPEX11-2 mediates membrane remodeling during peroxisome proliferation in germinating rice seeds .

What are the key unresolved questions regarding OsPEX11-2 function in rice development?

Several critical questions about OsPEX11-2 remain unresolved:

Developmental regulation:

  • What transcription factors and signaling pathways regulate the highly specific expression of OsPEX11-2 during seed germination?

  • How is OsPEX11-2 expression coordinated with other germination-related metabolic pathways?

  • Why has OsPEX11-2 evolved seed-specific expression while other PEX11 family members show broader expression patterns?

Molecular mechanism:

  • Does OsPEX11-2 function autonomously or require specific interaction partners for peroxisome proliferation?

  • What is the precise membrane deformation mechanism employed by OsPEX11-2?

  • How does OsPEX11-2 coordinate with the peroxisome division machinery in rice?

Physiological significance:

  • What specific metabolic pathways during seed germination require OsPEX11-2-mediated peroxisome proliferation?

  • How do OsPEX11-2 and OsPEX11-3 (its closest paralog) functionally differ despite their close evolutionary relationship?

  • What are the consequences of OsPEX11-2 dysfunction for seedling establishment under different environmental conditions?

Evolutionary questions:

  • Why has OsPEX11-2 retained its specialized function despite duplication events?

  • How do functional differences between rice and Arabidopsis PEX11 proteins relate to monocot-dicot physiological differences?

Addressing these questions would significantly advance our understanding of peroxisome biology in crop plants and potentially reveal novel strategies for improving early seedling vigor in rice .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.