Recombinant Oryza sativa subsp. japonica Peroxisomal membrane protein 11-4 (PEX11-4)

Shipped with Ice Packs
In Stock

Description

Functional Roles in Peroxisome Biology

PEX11-4 is integral to peroxisome dynamics, including membrane elongation, segregation, and organelle interactions:

Peroxisome Proliferation and Morphology

  • Membrane Elongation: PEX11 proteins induce elongated peroxisomes (JEPs) via amphipathic helix domains, enabling membrane curvature and fission .

  • Stress-Responsive Expression:

    Stress FactorEffect on PEX11-4
    Abscisic acid (ABA)Induced expression
    Hydrogen peroxideUpregulated transcription
    Salt stressResponsive expression
    Low nitrogenEnhanced expression

Tissue-Specific Expression

PEX11-4 is predominantly expressed in leaf tissues, aligning with its role in photorespiration-associated peroxisomes . Expression patterns include:

TissueExpression LevelFunctional Context
Flag leafHighest in vegetative stages Photorespiration, stress adaptation
RootModerate expression Nutrient mobilization, stress response
Germinated seedsLow/no expression Glyoxysome function (limited role)

Organelle Contact and Interactions

PEX11-4 interacts with components of the ERMES complex (e.g., Mdm34), mediating peroxisome-mitochondria contacts . Deletion of ERMES components disrupts PEX11-4 localization, highlighting its role in organelle tethering .

Stress Adaptation Mechanisms

  • Abiotic Stress: PEX11-4 is upregulated under ABA, H₂O₂, salt, and nitrogen deprivation, suggesting involvement in reactive oxygen species (ROS) detoxification and metabolic reprogramming .

  • Protein Stability: PEX11-4 levels are reduced in pex3Δ mutants, indicating feedback regulation linked to peroxisome membrane integrity .

Experimental Tools

Recombinant PEX11-4 is used in:

  • Subcellular Localization Studies: Tracking peroxisome dynamics via GFP-tagged fusion proteins .

  • Protein Interaction Assays: Identifying binding partners (e.g., Mdm34, Tom22) using membrane yeast two-hybrid (MYTH) and bimolecular fluorescence complementation (BiFC) .

Comparative Analysis of PEX11 Isoforms

Rice PEX11 family members exhibit divergent roles:

IsoformTissue ExpressionStress ResponseProposed Function
PEX11-1Leaves, shootsABA, H₂O₂, salt, low NPhotorespiration, stress adaptation
PEX11-3Endosperm, germinated seedsABA, H₂O₂Glyoxysome biogenesis
PEX11-5All tissuesABA, H₂O₂, saltGeneral peroxisome maintenance
PEX11-4Leaves, flag leafABA, H₂O₂, salt, low NPhotorespiration, stress adaptation

Data synthesized from .

Production and Handling Guidelines

ParameterRecommendation
Storage-20°C/-80°C (lyophilized); 4°C for short-term aliquots
ReconstitutionAvoid repeated freeze-thaw cycles; use sterile deionized water
Stability>90% purity confirmed via SDS-PAGE; functional activity validated in studies

Future Research Directions

  1. Structural Studies: Resolving PEX11-4’s amphipathic helix structure to elucidate membrane curvature mechanisms.

  2. Stress Signaling: Mapping downstream pathways activated by PEX11-4 under abiotic stress.

  3. Crop Engineering: Leveraging PEX11-4 for enhancing stress tolerance in rice cultivars.

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
PEX11-4; Os04g0534600; LOC_Os04g45210; OsJ_014940; OSJNBb0020O11.14; Peroxisomal membrane protein 11-4; OsPEX11-4; Peroxin-11-4
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-222
Protein Length
full length protein
Species
Oryza sativa subsp. japonica (Rice)
Target Names
PEX11-4
Target Protein Sequence
MSAGDTLDKLVVFLAKRDGIDKLVKTFQYVSKLAHWAAESSSPGLAGRAKNWETSAGLSR KAFRTGRFLTGLNGLRRAPGEFGALAVLANAGEMVYFFFDHFTWLSRVGVLDAWLARRMS FISAFGESVGYVFFIAMDLIMIRRGLRQERKLLREGGKDKDKEVKKIRMDRVMRLMATAA NVADLVIGIADIEPNPFCNHAVTLGISGLVSAWAGWYRNWPS
Uniprot No.

Target Background

Function

Involved in peroxisomal proliferation.

Database Links
Protein Families
Peroxin-11 family
Subcellular Location
Peroxisome membrane; Multi-pass membrane protein.
Tissue Specificity
Expressed in seedlings, shoots, leaf sheaths and flag leaf.

Q&A

What is PEX11-4 and what is its role in rice cellular function?

PEX11-4 (Peroxisomal Membrane Protein 11-4) is one of five PEX11 family members in rice (Oryza sativa) involved in peroxisome biogenesis. The PEX11 gene family plays a crucial role in peroxisome proliferation and division in eukaryotic cells. In rice specifically, PEX11-4 is part of a diversified gene family that has evolved with distinct expression patterns and responses to environmental stresses. Research indicates that PEX11 proteins are sufficient to induce peroxisome division through a mechanism independent of metabolic processes, suggesting a direct regulatory role in organelle biogenesis .

Methodologically, researchers interested in PEX11-4 function should consider both loss-of-function and gain-of-function approaches. Studies in other model systems have demonstrated that overexpression of PEX11 proteins leads to increased peroxisome abundance, while deletion can reduce peroxisome numbers. Similar experimental designs could be applied to rice PEX11-4 to elucidate its specific functions in monocot species.

How does PEX11-4 expression vary across rice tissues and developmental stages?

Expression profile analyses reveal that PEX11-4 has a tissue-specific expression pattern, with significantly higher expression levels in leaf tissues compared to other parts of the rice plant . This spatial specificity suggests a specialized role for PEX11-4 in leaf peroxisome dynamics, potentially linked to photosynthesis or photorespiration processes.

For researchers studying developmental regulation of PEX11-4, it is important to note that unlike some other PEX11 family members (such as OsPEX11-2, which is detected only in germinated seeds, or OsPEX11-3, which is predominantly expressed in endosperm and germinated seeds), PEX11-4 maintains a more leaf-centric expression profile throughout development .

Methodologically, RT-PCR analysis across multiple tissues and developmental stages provides the most comprehensive picture of PEX11-4 expression patterns. Researchers should consider analyzing at least eight distinct tissues including shoot at 2 tiller stage, leaves at different developmental stages, endosperm, and flag leaf to capture the complete expression profile .

How does PEX11-4 respond to different abiotic stresses in rice?

PEX11-4 expression is significantly responsive to multiple abiotic stresses. Research has demonstrated that OsPEX11-4 is induced by abscisic acid (ABA), hydrogen peroxide (H₂O₂), salt stress, and low nitrogen conditions . This stress responsiveness distinguishes it from some other family members, such as OsPEX11-2, which shows no response to these stresses.

The differential stress response pattern suggests PEX11-4 may play a role in peroxisome-mediated stress adaptation mechanisms. The induction by both ABA and H₂O₂ is particularly noteworthy, as it indicates potential involvement in both hormonal and reactive oxygen species (ROS) signaling pathways.

For researchers investigating stress responses, quantitative RT-PCR with appropriate reference genes is recommended, with sampling at multiple time points after stress application to capture both early and late response patterns.

What signaling pathways might regulate PEX11-4 expression?

Based on its responsiveness to ABA and H₂O₂, PEX11-4 likely interfaces with multiple stress signaling pathways . The ABA-inducible nature suggests regulation through traditional ABA-responsive elements (ABREs) in its promoter, while H₂O₂ responsiveness indicates potential regulation through redox-sensitive transcription factors.

Methodologically, researchers can investigate these regulatory mechanisms through:

  • Promoter analysis to identify potential regulatory elements

  • Chromatin immunoprecipitation (ChIP) assays to identify transcription factors binding to the PEX11-4 promoter

  • Reporter gene assays with promoter deletions to map functional regulatory regions

These approaches would help elucidate the complex regulatory network controlling PEX11-4 expression under various stress conditions and developmental stages.

What expression systems are optimal for producing recombinant PEX11-4 protein?

For researchers aiming to produce recombinant PEX11-4 for functional or structural studies, E. coli-based expression systems have been successfully employed . The available literature indicates that full-length PEX11-4 (amino acids 1-222) with a His-tag has been successfully expressed and purified from E. coli.

When designing expression constructs, researchers should consider:

  • The potential impact of tags on protein function

  • Codon optimization for the expression host

  • Inclusion of appropriate protease cleavage sites if tag removal is desired

  • Expression conditions that minimize aggregation of this membrane protein

Additional considerations for membrane protein expression may include the use of specialized E. coli strains or alternative eukaryotic expression systems if functional studies require proper membrane insertion.

How can researchers effectively study the function of PEX11-4 in peroxisome proliferation?

Based on established methodologies for studying PEX11 function, several experimental approaches are recommended:

  • Genetic manipulation studies: Creating overexpression lines and knockdown/knockout mutants of PEX11-4 in rice to observe effects on peroxisome number and morphology .

  • Fluorescent protein fusion approaches: Generation of PEX11-4-GFP fusion constructs to visualize protein localization and dynamics during peroxisome proliferation in live cells .

  • Immunolocalization: Using specific antibodies against PEX11-4 to track its subcellular distribution during different developmental stages or stress conditions.

  • Complementation assays: Testing whether rice PEX11-4 can complement yeast or mammalian PEX11 mutants to establish functional conservation across species.

These approaches should be combined with quantitative peroxisome counting and morphological analysis using confocal microscopy and appropriate peroxisomal markers.

How does PEX11-4 compare to other members of the rice PEX11 family?

Rice contains five PEX11 genes (OsPEX11-1 through OsPEX11-5), each with distinct expression patterns and stress responses . Comparative analysis reveals:

PEX11 MemberPrimary Expression SitesStress ResponsivenessNotable Features
OsPEX11-1Leaf tissuesABA, H₂O₂, salt, low nitrogenSimilar expression pattern to PEX11-4
OsPEX11-2Germinated seeds onlyNone observedLikely duplicated with PEX11-3
OsPEX11-3Endosperm, germinated seedsABA, H₂O₂Likely duplicated with PEX11-2
OsPEX11-4Leaf tissuesABA, H₂O₂, salt, low nitrogenFocus of this FAQ
OsPEX11-5All tissues investigatedABA, H₂O₂, saltMost broadly expressed

This diversity in expression patterns and stress responses suggests functional specialization among PEX11 family members in rice . For researchers studying functional divergence, comparative phenotypic analysis of mutants for each family member would provide valuable insights.

How is PEX11-4 evolutionarily related to PEX11 proteins in other species?

Phylogenetic analysis indicates that PEX11 sequences from rice and other species can be classified into three major groups . Among the rice PEX11 genes, OsPEX11-2 and OsPEX11-3 are most likely duplicated, suggesting a recent evolutionary event specific to rice or closely related species.

For researchers investigating evolutionary aspects of PEX11 proteins, selection analysis provides insights into functional constraints. The ratio of non-synonymous to synonymous substitutions (Ka/Ks) can reveal whether these genes have undergone purifying selection, neutral selection, or positive selection . This information helps understand the evolutionary forces shaping PEX11 diversity across species.

Methodologically, researchers should employ multiple sequence alignment tools, phylogenetic tree construction methods, and selection analysis software to comprehensively analyze the evolutionary relationships and selective pressures on PEX11-4.

What protein interactions might mediate PEX11-4 function in peroxisome division?

While specific interaction partners for rice PEX11-4 have not been definitively established in the provided search results, research on PEX11 proteins in other organisms suggests potential interactions with dynamin-related proteins like VPS1 and motor proteins such as MYO2, which control peroxisome division .

For researchers investigating protein interactions, several methodological approaches are recommended:

  • Immunoprecipitation: This technique can identify protein-protein interactions by precipitating PEX11-4 along with its binding partners using specific antibodies .

  • Yeast two-hybrid screening: This method can be used to screen for potential interacting proteins from a rice cDNA library.

  • Split-GFP or FRET approaches: These techniques allow visualization of protein interactions in living cells.

  • Mass spectrometry following co-immunoprecipitation: This provides an unbiased approach to identify the complete interactome of PEX11-4.

Understanding these interactions will provide critical insights into the mechanism by which PEX11-4 promotes peroxisome division.

How might researchers distinguish between metabolic and direct effects of PEX11-4 on peroxisome proliferation?

An important conceptual advance in PEX11 research is the recognition that these proteins can stimulate peroxisome division independently of metabolic processes . To distinguish between direct effects on peroxisome division machinery versus indirect effects through metabolic pathways, researchers should consider the following experimental approaches:

  • Expression in metabolic mutant backgrounds: Express PEX11-4 in rice lines deficient in key peroxisomal metabolic enzymes (similar to the pox1 derivative experiments described for yeast ) to determine if peroxisome proliferation still occurs.

  • Time-course microscopy studies: Monitor the kinetics of peroxisome elongation and division following controlled induction of PEX11-4 expression, as changes occurring before metabolic adaptations would suggest direct effects.

  • Domain mutation analysis: Create targeted mutations in PEX11-4 functional domains to separate potential metabolic functions from division-promoting activities.

  • In vitro membrane deformation assays: Purified PEX11-4 could be tested for ability to directly deform artificial membranes, suggesting a direct physical role in membrane remodeling.

These approaches would help elucidate whether PEX11-4 directly participates in the mechanics of peroxisome division or primarily functions through metabolic regulation.

What are the critical controls needed when studying PEX11-4 overexpression effects?

When studying the effects of PEX11-4 overexpression on peroxisome proliferation, several critical controls should be implemented:

  • Overexpression of other peroxisomal membrane proteins (PMPs): As demonstrated in previous research, overexpression of other PMPs like PEX13 does not increase peroxisome numbers . Including such controls helps establish the specificity of PEX11-4's effects.

  • Verification of construct functionality: Researchers should verify that their PEX11-4 construct is functional and properly expressed, addressing concerns about plasmid uptake and protein expression levels .

  • Impact of epitope tags: Testing whether tags like myc or GFP affect protein conformation and function is essential, as these could potentially disrupt normal protein activity .

  • Appropriate time course analysis: Peroxisome proliferation should be monitored at multiple time points (e.g., 1.5-2 hours, 4-8 hours, and 24-48 hours post-induction) to capture the kinetic steps of the process .

These controls help ensure that observed peroxisome proliferation is specifically attributable to PEX11-4 function rather than experimental artifacts.

How can researchers accurately quantify peroxisome abundance when studying PEX11-4?

Accurate quantification of peroxisome abundance is critical when evaluating PEX11-4 function. Based on methodologies described in the literature, researchers should consider:

  • Multiple peroxisomal markers: Use both endogenous peroxisomal markers (like catalase or PEX14) and introduced markers (such as GFP-PTS1) to ensure comprehensive detection of all peroxisomes .

  • Automated image analysis: Implement computational approaches for unbiased counting of peroxisome numbers across multiple cells and experiments.

  • Statistical rigor: Analyze sufficient numbers of cells (typically >50 per condition) to account for cell-to-cell variability, and apply appropriate statistical tests with error bars to present the data accurately .

  • 3D analysis when possible: Consider z-stack confocal microscopy to capture the full complement of peroxisomes throughout the cell volume rather than just a single plane.

These approaches minimize subjective bias and increase the reproducibility and reliability of peroxisome quantification in PEX11-4 functional studies.

What are promising future research directions for understanding PEX11-4 function in rice?

Several promising research directions emerge from current understanding of PEX11-4:

  • Stress adaptation mechanisms: Given its responsiveness to multiple abiotic stresses, investigating how PEX11-4-mediated peroxisome proliferation contributes to stress tolerance in rice could provide valuable insights for crop improvement .

  • Tissue-specific functions: Since PEX11-4 is predominantly expressed in leaf tissues, exploring its specific roles in leaf peroxisome dynamics, particularly in relation to photosynthesis and photorespiration, would be valuable .

  • Regulatory network analysis: Identifying transcription factors and signaling components that regulate PEX11-4 expression under different conditions would help understand how peroxisome proliferation is integrated with cellular needs.

  • Structure-function analysis: Detailed investigation of how the three conserved motifs in PEX11-4 contribute to its function would enhance understanding of the molecular mechanisms of peroxisome division.

  • Crop improvement applications: Exploring whether modulation of PEX11-4 expression could enhance stress tolerance in rice and potentially other crops represents an applied direction with significant potential impact.

These directions would significantly advance understanding of both fundamental peroxisome biology and potential applications in crop improvement.

What methodological challenges remain in studying PEX11-4 function?

Despite advances in understanding PEX11 proteins, several methodological challenges remain for researchers studying PEX11-4:

  • Membrane protein purification: As a membrane protein, PEX11-4 presents challenges for high-yield purification in functional form, particularly for structural studies.

  • Distinguishing primary from secondary effects: Determining whether observed phenotypes are direct consequences of PEX11-4 function or secondary adaptations remains challenging.

  • Temporal resolution of division events: Capturing the dynamic process of peroxisome division with sufficient temporal resolution to elucidate the precise sequence of events requires advanced live imaging techniques.

  • Functional redundancy: Potential functional overlap among the five rice PEX11 proteins may obscure phenotypes in single gene manipulation studies.

  • Translation to field conditions: Bridging laboratory findings on PEX11-4 stress responses to actual field performance of rice under variable environments remains a significant challenge.

Addressing these methodological challenges will require interdisciplinary approaches combining advanced imaging, biochemical techniques, genetic tools, and field studies.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.