Recombinant Oryza sativa subsp. japonica Peroxisomal membrane protein 11-5 (PEX11-5)

Shipped with Ice Packs
In Stock

Description

General Information

Oryza sativa subsp. japonica Peroxisomal Membrane Protein 11-5 (PEX11-5) is a protein belonging to the PEX11 family, which is involved in peroxisome biogenesis . Peroxisomes are single membrane-bound organelles that contain enzymes like catalase and H2_2O2_2-producing flavin oxidases and participate in primary and secondary metabolism, plant development, and responses to abiotic stress .

Gene Expression and Function

Comprehensive sequence and expression profile analysis reveal that the PEX11 gene family in rice has differential expression patterns . OsPEX11-5 is expressed in all tissues examined, with the highest expression in callus . Higher expression is also detected in endosperm, root, and germinated seeds . OsPEX11-5 responds to abscisic acid (ABA), H2_2O2_2, and salt treatments .

Role in Stress Tolerance

OsPEX11 contributes to salt stress tolerance by modulating the expression of cation transporters and antioxidant defense . Overexpression of OsPEX11 results in plants with better tolerance to salt stress, lower levels of lipid peroxidation, a lower Na+{}^+/K+{}^+ ratio, and higher activities of antioxidant enzymes (SOD, POD, and CAT), as well as increased proline accumulation . OsPEX11 acts as a positive regulator of salt tolerance by reinforcing the expression of rice transporters involved in Na+{}^+/K+{}^+ homeostasis in transgenic plants under salinity .

Under saline stress, OsPEX11 overexpression protects plants by dynamically modulating antioxidant enzymes (SOD, POD, and CAT) and proline accumulation, which reduces lipid peroxidation. It also regulates Na+{}^+/K+{}^+ transporter proteins, restricting the entry of excess Na+{}^+ and facilitating its sequestration in vacuoles via NHX1 .

PEX11 and Peroxisome Division

Pex11 proteins have a recognized role in peroxisome division, remodeling, and elongating peroxisomal membranes . Deletion of PEX11C or PEX11/25 affects peroxisome dynamics, resulting in fewer and larger peroxisomes compared to wild-type cells .

Interaction with Mitochondria

Pex11 interacts with Mdm34 and plays a role in establishing contact sites between peroxisomes and mitochondria .

Expression Patterns Under Abiotic Stresses

StressGeneExpression Pattern
Abscisic Acid (ABA)OsPEX11-1Increased at 30 min after treatment, remained elevated until 12 h, then decreased
OsPEX11-3Responsive to ABA treatment
OsPEX11-5Responsive to ABA treatment
Hydrogen PeroxideOsPEX11-1Responsive to H2_2O2_2 treatments
OsPEX11-3Responsive to H2_2O2_2 treatments
OsPEX11-5Responsive to H2_2O2_2 treatments
SalinityOsPEX11-1Increased from 30 min to 2 h after treatment, then decreased
OsPEX11-3Increased at 30 min after treatment, then decreased
OsPEX11-4Increased at 1 h after treatment, then decreased
OsPEX11-5Increased after 30 min of stress, continued to increase until 2 h, then decreased
Low NitrogenOsPEX11-1Increased at 6 and 12 h after stress, then decreased
OsPEX11-3No expression at any time interval
OsPEX11-4Increased at 6 h after stress, then decreased

Product Specs

Form
Lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which may serve as a reference for your protocols.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and inherent protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
If you require a specific tag type, please inform us; we will prioritize its development.
Synonyms
PEX11-5; Os06g0127000; LOC_Os06g03660; OSJNBa0038F22.10-1; P0425F02.44-1; Peroxisomal membrane protein 11-5; OsPEX11-2; OsPEX11-5; Peroxin-11-5
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-233
Protein Length
full length protein
Species
Oryza sativa subsp. japonica (Rice)
Target Names
PEX11-5
Target Protein Sequence
MSSLESARADLALLILYLNKAEARDKICRAIQYGSKFVSNGQPGPAQNVDKSTSLARKVF RLFKFVNDLHALISPPAKGTPLPLILLGKSKNALLSTFLFLDQIVWAGRTGIYKNKERAE FLSKIAFYCFLGSNTCTSIIEVAELQRLSKSMKKLEKELKHQELLKNEQYQMKLQKCNER RLALIKSSLDIVVAIGLLQLAPKKVTPRVTGAFGFASSLIACYQLLPAPAKSK
Uniprot No.

Target Background

Function
This protein is involved in peroxisomal proliferation.
Database Links
Protein Families
Peroxin-11 family
Subcellular Location
Peroxisome membrane; Multi-pass membrane protein.
Tissue Specificity
Expressed in seedlings, roots, shoots, leaf sheaths, flag leaf, panicles, spikelets, and endosperm.

Q&A

What is the genomic context of PEX11-5 in Oryza sativa subsp. japonica?

PEX11-5 is one of five members of the peroxisomal membrane protein 11 (PEX11) family in rice. The rice genome contains five putative PEX11 genes (OsPEX11-1 through OsPEX11-5), each containing three conserved motifs that characterize this protein family . Within the context of the completely annotated genome of Oryza sativa L. ssp. japonica cultivar Nipponbare, PEX11 genes represent part of the approximately 32,000 genes that have been identified through rigorous annotation efforts . Phylogenetic analysis has revealed that plant PEX11 proteins can be divided into distinct groups, with OsPEX11-5 belonging to the subclade containing AtPEX11a and OsPEX11-3 .

How does PEX11-5 function differ from other PEX11 family members in rice?

PEX11-5 in rice displays distinct expression patterns compared to other family members. While OsPEX11-1 and OsPEX11-4 have higher expression in leaf tissues, OsPEX11-2 is detected only in germinated seeds, and OsPEX11-3 is expressed predominantly in endosperm and germinated seeds, OsPEX11-5 demonstrates a broader expression profile, being expressed in all tissues investigated . This ubiquitous expression pattern suggests PEX11-5 may play a more general role in peroxisome biology across different rice tissues, unlike its more tissue-specific counterparts.

Furthermore, PEX11-5 shows distinct stress responses, being responsive to abscisic acid (ABA), hydrogen peroxide (H₂O₂), and salt treatments, but not necessarily to all the same stressors that affect other family members . This suggests specialized functions in stress adaptation pathways.

What is the subcellular localization of PEX11-5 and how can it be verified experimentally?

PEX11-5, like other PEX11 family members, localizes to the peroxisomal membrane. This can be experimentally verified through several complementary approaches:

  • Fluorescent protein fusion: Create a cyan fluorescent protein (CFP) or green fluorescent protein (GFP) fusion with PEX11-5 and express it in plant cells alongside a known peroxisomal marker such as yellow fluorescent protein fused with the peroxisomal targeting signal type 1 (YFP-PTS1) . Colocalization of fluorescence signals confirms peroxisomal targeting.

  • Immunobiochemical analysis: Use highly purified peroxisomes isolated from rice tissues and perform Western blot analysis using antibodies specific to PEX11-5 .

  • Membrane association analysis: Perform membrane fractionation experiments to determine whether PEX11-5 behaves as an integral protein of the peroxisome membrane, similar to what has been demonstrated for other PEX11 family members .

What is the tissue-specific expression pattern of PEX11-5 in rice?

OsPEX11-5 exhibits a broad expression pattern across rice tissues. Unlike other PEX11 family members that show tissue-specific expression, OsPEX11-5 is expressed in all tissues investigated, including leaves, roots, endosperm, and germinated seeds . This ubiquitous expression suggests that PEX11-5 may play a fundamental role in peroxisome biology throughout the plant.

The expression profile can be experimentally determined using:

  • RT-PCR analysis with tissue-specific RNA samples

  • Quantitative real-time PCR for precise quantification across tissues

  • Promoter-reporter gene fusions to visualize expression patterns in planta

  • Analysis of web-based microarray databases to compare expression across different developmental stages and conditions

How is PEX11-5 expression affected by different abiotic stresses?

OsPEX11-5 shows specific responses to various abiotic stresses. Research has demonstrated that OsPEX11-5 is significantly upregulated in response to:

  • Abscisic acid (ABA) treatment

  • Hydrogen peroxide (H₂O₂) exposure

  • Salt stress conditions

These stress-responsive expression patterns suggest that PEX11-5 may play important roles in plant adaptation to environmental challenges, potentially through modulating peroxisome abundance and function during stress responses.

What experimental approaches can be used to determine the function of PEX11-5 in peroxisome proliferation?

To characterize the role of PEX11-5 in peroxisome proliferation, several experimental approaches can be employed:

  • Overexpression studies: Generate transgenic rice lines overexpressing PEX11-5 under a constitutive promoter and quantify peroxisome number and morphology using fluorescent microscopy with peroxisome markers .

  • Gene silencing or knockout: Use RNA interference (RNAi) or CRISPR/Cas9 gene editing to reduce PEX11-5 expression or create knockout lines, followed by assessment of peroxisome abundance and morphology .

  • Heterologous expression: Express rice PEX11-5 in yeast pex11 null mutants to assess complementation of growth phenotypes on oleic acid media and effects on peroxisome number and size .

  • Protein interaction studies: Identify potential PEX11-5 interacting partners through yeast two-hybrid assays, co-immunoprecipitation, or bimolecular fluorescence complementation to understand the molecular mechanisms of its function.

Based on studies with Arabidopsis PEX11 proteins, overexpression of PEX11 genes induces peroxisome proliferation, while reduction in gene expression decreases peroxisome abundance . Similar approaches with rice PEX11-5 would help establish its specific role in rice peroxisome dynamics.

Can PEX11-5 complement PEX11 function in other species?

Cross-species complementation experiments provide valuable insights into functional conservation. Based on studies with Arabidopsis PEX11 proteins, different family members show varying abilities to complement the Saccharomyces cerevisiae pex11 null mutant . For example, AtPEX11c and AtPEX11e significantly complemented the growth phenotype of yeast pex11 null mutants on oleic acid, while AtPEX11a, AtPEX11b, and AtPEX11d did not .

To determine whether rice PEX11-5 can complement PEX11 function in other species:

  • Express rice PEX11-5 in S. cerevisiae pex11 null mutants and assess growth on media containing oleic acid as the sole carbon source.

  • Analyze peroxisome number and size in the complemented yeast cells using fluorescence microscopy.

  • Perform similar complementation studies in Arabidopsis pex11 mutants.

These experiments would provide insights into the functional conservation of PEX11-5 across species and potentially reveal specific aspects of its molecular function.

What is known about the protein structure of PEX11-5 and how does it relate to its function?

PEX11-5, like other members of the PEX11 family, contains three conserved motifs that are characteristic of this protein family . These conserved regions likely play important roles in the protein's function and interactions.

Key structural features to consider include:

  • Transmembrane domains: As a peroxisomal membrane protein, PEX11-5 likely contains hydrophobic regions that anchor it to the peroxisomal membrane.

  • Protein interaction domains: Regions that mediate interactions with other proteins involved in peroxisome dynamics and membrane remodeling.

  • Post-translational modification sites: Potential phosphorylation or other modification sites that may regulate PEX11-5 activity.

Experimental approaches to elucidate structure-function relationships include:

  • Bioinformatic analysis of protein sequence to predict structural elements

  • Site-directed mutagenesis of conserved residues to assess their importance

  • Domain swapping between different PEX11 family members to identify functional regions

  • Structural studies using techniques such as X-ray crystallography or cryo-electron microscopy (though these are challenging for membrane proteins)

How does PEX11-5 contribute to peroxisome membrane dynamics?

PEX11 proteins are known to play major roles in peroxisome proliferation by influencing peroxisome membrane dynamics . While specific mechanisms for rice PEX11-5 have not been fully elucidated, insights can be drawn from studies of PEX11 proteins in other systems:

  • Membrane elongation: PEX11 proteins may induce the elongation of peroxisomal membranes as an initial step in peroxisome division.

  • Recruitment of division machinery: They may recruit proteins involved in membrane constriction and fission.

  • Membrane curvature: PEX11 proteins might directly affect membrane curvature through their insertion into the peroxisomal membrane.

In Arabidopsis, overexpression of PEX11 proteins causes distinct morphological changes to peroxisomes . Similar studies with rice PEX11-5 would help determine its specific role in peroxisome membrane dynamics.

Experimental approaches to study these mechanisms include:

  • Live-cell imaging of fluorescently tagged peroxisomes in cells with altered PEX11-5 expression

  • Electron microscopy to visualize peroxisome ultrastructure

  • In vitro membrane reconstitution assays to directly assess effects on membrane properties

How has PEX11-5 evolved in the context of plant evolution?

Phylogenetic analysis of PEX11 proteins across different species provides insights into the evolutionary history of PEX11-5. Plant PEX11 proteins can be divided into distinct groups, with rice OsPEX11-5 belonging to a subclade that includes AtPEX11a from Arabidopsis and OsPEX11-3 from rice .

The diversification of plant PEX11 genes occurred before the evolutionary split of monocots from dicots, suggesting ancient gene duplication events . The presence of five PEX11 genes in rice compared to three major phylogenetically distinct subfamilies in Arabidopsis (PEX11a, PEX11b, and PEX11c to PEX11e) indicates lineage-specific expansions and potential functional specialization .

To further investigate the evolutionary history of PEX11-5:

  • Perform comprehensive phylogenetic analyses including PEX11 sequences from a wide range of plant species

  • Analyze selection pressures acting on different regions of the protein

  • Compare syntenic genomic regions containing PEX11 genes across species to identify conserved gene arrangements

How do the expression patterns of PEX11-5 compare between rice and other plant species?

Comparative expression analysis between rice PEX11-5 and its homologs in other plant species reveals both similarities and differences:

  • Rice OsPEX11-5 is expressed in all tissues investigated , while in Arabidopsis, AtPEX11a (which belongs to the same phylogenetic subclade) shows different expression patterns, with higher expression in siliques .

  • Stress responsiveness appears to be a conserved feature, with both rice and Arabidopsis PEX11 genes showing responses to various abiotic stresses, though the specific stress responses may differ between homologs .

  • The diversification in expression patterns suggests that after gene duplication, PEX11 homologs likely underwent subfunctionalization or neofunctionalization, leading to specialized roles in different plant tissues and conditions.

To systematically compare expression patterns:

  • Analyze web-based microarray databases for expression data across multiple plant species

  • Perform comparative RT-PCR or RNA-seq experiments under standardized conditions

  • Examine promoter regions for conserved regulatory elements that might explain shared expression patterns

What are the best approaches for generating recombinant PEX11-5 for in vitro studies?

For in vitro studies with recombinant PEX11-5, researchers should consider the following approaches:

  • Expression system selection:

    • Bacterial expression (E. coli): Suitable for producing the soluble domains of PEX11-5, but may be challenging for full-length membrane protein expression

    • Yeast expression (P. pastoris or S. cerevisiae): Better for full-length membrane protein expression

    • Insect cell expression: Offers eukaryotic post-translational modifications

    • Plant-based expression systems: Provides the most native environment for rice proteins

  • Fusion tags and constructs:

    • N-terminal or C-terminal His-tag for purification

    • GST or MBP fusion to enhance solubility

    • Fluorescent protein fusions (GFP, CFP) for localization studies

    • Truncated constructs focusing on specific domains

  • Purification strategy:

    • Detergent solubilization protocols optimized for membrane proteins

    • Affinity chromatography followed by size exclusion chromatography

    • Native purification conditions to maintain protein structure and function

  • Functional validation:

    • Circular dichroism to assess secondary structure

    • Protein reconstitution into liposomes to study membrane effects

    • In vitro interaction assays with potential binding partners

What methods are most effective for studying PEX11-5 function in vivo?

To investigate PEX11-5 function in planta, several complementary approaches can be employed:

  • Genetic manipulation:

    • Overexpression: Create transgenic rice lines expressing PEX11-5 under constitutive (35S) or inducible promoters to study gain-of-function effects

    • Gene silencing: Use RNAi or CRISPR/Cas9 to reduce or eliminate PEX11-5 expression

    • Promoter-reporter fusions: Study expression patterns using PEX11-5 promoter driving reporter genes

  • Peroxisome visualization and quantification:

    • Fluorescent protein markers targeted to peroxisomes (YFP-PTS1)

    • Immunofluorescence microscopy using antibodies against peroxisomal proteins

    • Electron microscopy for ultrastructural analysis

    • Automated image analysis for quantifying peroxisome number, size, and morphology

  • Physiological and biochemical analyses:

    • Stress tolerance assays under conditions where PEX11-5 is upregulated (ABA, H₂O₂, salt)

    • Measurement of peroxisomal metabolic activities (fatty acid β-oxidation, ROS metabolism)

    • Analysis of metabolite profiles in plants with altered PEX11-5 expression

  • Protein interaction studies:

    • Co-immunoprecipitation to identify in vivo protein complexes

    • Bimolecular fluorescence complementation to visualize protein interactions in living cells

    • Proximity labeling approaches (BioID, APEX) to identify the proximal proteome

How does PEX11-5 function integrate with other cellular pathways during stress responses?

PEX11-5 is upregulated in response to several stresses, including ABA, H₂O₂, and salt treatments , suggesting integration with broader stress response networks. Future research should investigate:

  • Signaling pathways connecting stress perception to PEX11-5 upregulation:

    • Analysis of the PEX11-5 promoter for stress-responsive elements

    • Investigation of transcription factors regulating PEX11-5 expression

    • Characterization of post-translational modifications of PEX11-5 during stress

  • Metabolic adjustments mediated by peroxisome proliferation:

    • Changes in peroxisomal metabolism during stress conditions

    • Impact of altered PEX11-5 expression on metabolite profiles

    • Role of peroxisome-derived signaling molecules in stress adaptation

  • Coordination with other organelles:

    • Peroxisome-chloroplast interactions during oxidative stress

    • Peroxisome-mitochondria coordination in energy metabolism

    • Relationship between ER and peroxisomes in membrane dynamics

  • Comparative analysis across stresses:

    • Differences in peroxisome behavior under various stress conditions

    • Stress-specific protein interaction networks involving PEX11-5

    • Temporal dynamics of PEX11-5 expression and peroxisome proliferation during stress progression

What are the differential roles of PEX11 family members and how do they coordinate in rice?

The rice genome contains five PEX11 genes with distinct expression patterns , raising questions about their functional specialization and coordination:

  • Tissue-specific functions:

    • OsPEX11-1 and OsPEX11-4: Higher expression in leaf tissues

    • OsPEX11-2: Detected only in germinated seeds

    • OsPEX11-3: Expressed predominantly in endosperm and germinated seeds

    • OsPEX11-5: Expressed in all tissues investigated

  • Stress-specific responses:

    • Different PEX11 members show distinct patterns of upregulation under various stresses

    • Potential specialized roles in different stress adaptation pathways

  • Redundancy vs. specialization:

    • Analysis of single and multiple pex11 mutants to assess functional redundancy

    • Investigation of peroxisome subtypes potentially regulated by different PEX11 proteins

    • Characterization of tissue-specific or development-specific peroxisome populations

  • Molecular basis for functional diversification:

    • Identification of specific protein domains responsible for specialized functions

    • Characterization of different protein interaction partners for each PEX11 family member

    • Analysis of promoter elements driving differential expression patterns

PEX11 GenePrimary Expression TissuesStress ResponsesPotential Specialized Functions
OsPEX11-1LeavesABA, H₂O₂, salt, low nitrogenPhotosynthesis-related peroxisome functions
OsPEX11-2Germinated seeds onlyNo responses observedSpecialized role in seed germination
OsPEX11-3Endosperm, germinated seedsABA, H₂O₂Seed development and germination processes
OsPEX11-4LeavesABA, H₂O₂, salt, low nitrogenPhotosynthesis-related peroxisome functions
OsPEX11-5All tissuesABA, H₂O₂, saltGeneral peroxisome maintenance and stress response

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.