Recombinant Oryza sativa subsp. japonica Phosphoenolpyruvate/phosphate translocator 1, chloroplastic (PPT1)

Shipped with Ice Packs
In Stock

Description

Functional Role in O. sativa subsp. japonica

PPT1 facilitates bidirectional PEP transport between chloroplasts and cytosol, though its net direction depends on metabolic demands:

  • Cytosol-to-Chloroplast Import: In C₃ plants like O. sativa, PPT1 primarily imports PEP from the cytosol into chloroplasts to support the shikimate pathway (phenylalanine, tyrosine, tryptophan synthesis) and fatty acid biosynthesis .

  • Bidirectional Transport in C₄ Plants: Evolutionary studies in Flaveria reveal that PPT1 retains bidirectional activity in C₄ species, enabling metabolic flexibility .

Key Functional Domains and Pathways

Domain/PathwayRole
Fatty Acid MetabolismPEP supplies precursors for plastidial fatty acid synthesis
Shikimate PathwayPEP serves as a substrate for aromatic amino acid production
Lysosomal DegradationNot directly relevant to O. sativa PPT1; human PPT1 homologs differ

Recombinant PPT1 Applications

ApplicationDetails
Metabolic EngineeringOverexpression of BnaPPT1 in B. napus increased seed oil content by 2.1–3.3%
Functional ComplementationFlaveria PPT1 complements Arabidopsis cue1 mutants, confirming conserved function

Evolutionary Conservation and Species-Specific Adaptations

PPT1 is evolutionarily conserved across plants, with structural and functional similarities observed between:

  • C₃ vs. C₄ Plants: Flaveria PPT1 retains bidirectional activity, while O. sativa PPT1 likely functions as a net importer .

  • Distant Relatives: Comparative genomics with Arabidopsis reveals shared functional domains but distinct gene duplication patterns .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you require a specific format, please indicate your preference in the order notes. We will accommodate your request whenever possible.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please contact your local distributor for specific delivery information.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance. Additional fees may apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial prior to opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our default glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and the protein's inherent stability.
Generally, liquid forms have a shelf life of 6 months at -20°C/-80°C. Lyophilized forms have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The specific tag type will be determined during production. If you have a preference for a particular tag, please specify it in your order. We will strive to incorporate your request whenever possible.
Synonyms
PPT1; Os09g0297400; LOC_Os09g12600; OJ1381_H04.7; OsJ_28749; P0592C05.31; Phosphoenolpyruvate/phosphate translocator 1, chloroplastic; OsPPT1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
67-408
Protein Length
Full Length of Mature Protein
Species
Oryza sativa subsp. japonica (Rice)
Target Names
Target Protein Sequence
ASPEQEDERRRGARDVAVAATAAAAGEAGAEEGGGLAKTLQLGALFGLWYLFNIYFNIYN KQVLKVFPYPINITNVQFAVGTVIALFMWITGILKRPKISGAQLAAILPLAMVHTMGNLF TNMSLGKVAVSFTHTIKAMEPFFSVLLSALFLGEMPTPFVVLSLVPIVGGVALASLTEAS FNWAGFWSAMASNVTFQSRNVLSKKLMVKKEESLDNITLFSIITVMSFFLLAPVTLLTEG VKVTPTVLQSAGLNLKQIYTRSLIAAFCFHAYQQVSYMILARVSPVTHSVGNCVKRVVVI VTSVLFFRTPVSPINSLGTGVALAGVFLYSQLKRLKPKPKTA
Uniprot No.

Target Background

Function
Phosphoenolpyruvate/phosphate translocator responsible for transporting phosphoenolpyruvate (PEP) and dihydroxyacetone phosphate.
Database Links

KEGG: osa:4346653

STRING: 39947.LOC_Os09g12600.1

UniGene: Os.4694

Protein Families
TPT transporter family, PPT (TC 2.A.7.9) subfamily
Subcellular Location
Plastid, chloroplast membrane; Multi-pass membrane protein.

Q&A

What is the function of Phosphoenolpyruvate/phosphate translocator 1 (PPT1) in rice chloroplasts?

PPT1 in rice chloroplasts primarily functions as a transporter that exchanges phosphoenolpyruvate (PEP) from the cytosol with inorganic phosphate (Pi) from the chloroplast stroma. This exchange is crucial for providing PEP as a substrate for the shikimate pathway within chloroplasts, which is essential for aromatic amino acid biosynthesis and subsequent production of various secondary metabolites including flavonoids. Similar to other phosphate transporters such as OsPHT2;1, PPT1 contributes significantly to phosphate homeostasis between cellular compartments . The transport activity of PPT1 is particularly important for maintaining optimal phosphate levels in the chloroplast stroma, which directly impacts photosynthetic efficiency. Additionally, PPT1 serves as a critical link between carbon metabolism and phosphate utilization, influencing metabolic coordination between chloroplastic and cytosolic compartments.

How is PPT1 structurally related to other phosphate transporters in rice?

PPT1 belongs to a specialized family of plastidic phosphate translocators that differs from other rice phosphate transporters in several key aspects. Unlike the PHT1 family transporters (OsPT2, OsPT6, OsPT8) that function primarily at the plasma membrane for phosphate uptake from soil, PPT1 contains specific transmembrane domains adapted for the chloroplast envelope . The protein shares some structural features with OsPHT2;1, another chloroplast-localized phosphate transporter, but differs in substrate specificity . While OsPHT2;1 primarily transports inorganic phosphate, PPT1 has evolved specific binding sites that enable counter-exchange of phosphoenolpyruvate and phosphate.

The protein structure includes:

  • A transit peptide targeting the protein to chloroplasts

  • Multiple transmembrane domains forming a substrate translocation pore

  • Substrate recognition regions specific for PEP and phosphate

  • Regulatory domains responsive to metabolic status and environmental conditions

PPT1 is structurally distinct from vacuolar phosphate transporters like OsSPX-MFS1, which contains SPX and MFS domains involved in vacuolar phosphate storage .

What are the expression patterns and regulation of PPT1 in rice?

The expression of PPT1 in rice follows specific patterns that reflect its physiological roles across development and in response to environmental conditions. While the precise expression profile isn't detailed in the search results, comparative analysis with similar transporters suggests several key characteristics:

The gene likely exhibits tissue-specific expression predominantly in photosynthetically active tissues, particularly leaf mesophyll cells with abundant chloroplasts. Similar to OsPHT2;1, PPT1 expression is likely responsive to both phosphate availability and light exposure . Under phosphate starvation conditions, expression may be upregulated to maximize efficient phosphate utilization and recycling. The regulation of PPT1 likely involves both transcriptional control and post-translational modifications.

Transcriptional regulation may involve:

  • Phosphate-responsive transcription factors similar to those regulating other phosphate transporters

  • Light-responsive elements in the promoter region

  • Developmental regulators controlling expression during leaf maturation

Post-translational regulation could include:

  • Phosphorylation by kinases similar to OsCK2, which phosphorylates other phosphate transporters like OsPHT1;8

  • Protein-protein interactions affecting localization or activity

  • Feedback inhibition by metabolic intermediates

What are optimal expression systems for recombinant rice PPT1?

The successful expression of functional recombinant PPT1 requires careful selection of expression systems and optimization of conditions. Based on approaches used for similar membrane transporters, the following systems and parameters should be considered:

Expression System Comparison:

Expression SystemAdvantagesLimitationsRecommended Applications
E. coliRapid growth, high yield, simple geneticsLimited post-translational modifications, inclusion body formationProtein fragments, antigen production
Pichia pastorisEukaryotic processing, high-density culturesLonger expression time, glycosylation patterns differ from plantsFunctional studies, structural analysis
Insect cellsSuperior folding of complex proteins, near-native modificationsHigher cost, technical complexityDetailed functional characterization, crystallography
Plant-based systemsNative-like modifications, proper targetingLower yields, longer timeframesIn planta function verification

Critical Optimization Parameters:

For bacterial expression:

  • Reduced temperature (16-20°C) during induction phase

  • Specialized fusion tags (SUMO, thioredoxin) to enhance solubility

  • Membrane-mimicking detergents during extraction (n-dodecyl-β-D-maltoside)

For eukaryotic expression:

  • Codon optimization for the host system

  • Signal sequence modifications for proper membrane targeting

  • Induction timing and strength optimization

The choice of expression system should be guided by the specific experimental objectives, whether generating antibodies, performing functional assays, or structural studies. For antibody production, bacterial expression of protein fragments may suffice, while functional characterization typically requires eukaryotic systems that better support membrane protein folding.

What techniques verify PPT1 subcellular localization in rice?

Confirming the chloroplast localization of PPT1 requires multiple complementary approaches to provide conclusive evidence. The following techniques offer a comprehensive strategy:

Fluorescent Protein Fusion Analysis:

  • Generation of PPT1-GFP fusion constructs under native or controlled promoters

  • Transient expression in rice protoplasts or stable transformation

  • Confocal microscopy visualization with co-localization analysis

  • Z-stack imaging to distinguish envelope from stromal localization

This approach is similar to methods used for confirming the chloroplast envelope localization of other transporters like OsPHT2;1 .

Biochemical Fractionation Methods:

  • Isolation of intact chloroplasts using Percoll gradient centrifugation

  • Subfractionation to separate envelope, stroma, and thylakoid components

  • Western blotting with PPT1-specific antibodies

  • Comparison with compartment-specific marker proteins:

    • Tic110 (inner envelope)

    • Toc75 (outer envelope)

    • RbcL (stroma)

    • PsbA (thylakoid)

Immunogold Electron Microscopy:

  • Fixation and embedding of rice leaf tissue

  • Ultra-thin sectioning (60-80 nm)

  • Immunogold labeling with PPT1-specific antibodies

  • Transmission electron microscopy imaging

  • Quantitative analysis of gold particle distribution

A multi-method approach is essential as each technique has specific strengths and limitations. The combination of in vivo fluorescence imaging, biochemical fractionation, and high-resolution electron microscopy provides robust evidence for the precise subcellular localization of PPT1.

What methods effectively measure PPT1 transport activity?

Characterizing PPT1 transport activity requires specialized techniques that can quantify the counter-exchange of phosphoenolpyruvate and inorganic phosphate across membranes. The following approaches provide comprehensive functional assessment:

Reconstituted Liposome-Based Transport Assays:

This gold-standard approach involves:

  • Purification of recombinant PPT1 protein

  • Reconstitution into liposomes with defined lipid composition

  • Loading liposomes with internal substrate (typically Pi)

  • Initiation of transport by adding external substrate (PEP)

  • Quantification using radioisotope-labeled substrates (32P or 14C)

Transport Kinetics Determination:

Transport assays should measure:

  • Initial rates at varying substrate concentrations

  • Inhibitor effects on transport activity

  • pH and temperature dependence

  • Countersubstrate stimulation effects

A typical experiment might involve:

  • Preparation of proteoliposomes containing purified PPT1

  • Pre-loading with 10 mM Pi

  • Dilution into media containing [14C]PEP at concentrations from 0.05-5 mM

  • Sampling at 15, 30, 60, and 120 seconds

  • Filtration and scintillation counting

  • Analysis using Michaelis-Menten kinetics

Similar approaches have been used for characterizing other plastidic transporters, with patch clamp analysis providing complementary electrophysiological data for transporters like those described in result .

Heterologous Expression Systems:

For preliminary functional characterization:

  • Expression in yeast mutants deficient in related transport activities

  • Complementation analysis of growth phenotypes

  • Radiotracer uptake studies in whole cells

These methods collectively provide a comprehensive characterization of transport properties, substrate specificity, and regulatory mechanisms of PPT1.

How does PPT1 activity influence carbon partitioning and photosynthesis?

Influence on Metabolic Pathways:

PPT1 directly affects carbon flux through the shikimate pathway by controlling PEP availability in chloroplasts. This pathway is essential for aromatic amino acid synthesis and production of numerous secondary metabolites including flavonoids and lignin precursors. Similar to observations with OsPHT2;1, alterations in PPT1 activity likely affect flavonoid accumulation, which influences UV tolerance in rice . The transporter also indirectly impacts carbon partitioning between competing pathways by influencing stromal phosphate levels, which regulate key metabolic enzymes.

Effects on Photosynthetic Parameters:

  • Stromal phosphate homeostasis: PPT1-mediated Pi/PEP exchange contributes to maintaining optimal Pi levels within chloroplasts, which is critical for:

    • ATP synthesis through photophosphorylation

    • Calvin cycle activity and carbon fixation rates

    • Activation states of key stromal enzymes

  • Photosynthetic efficiency: Studies on related transporters like OsPHT2;1 show that mutations affecting phosphate transport lead to reduced photosynthetic rates . Similarly, alterations in PPT1 function would affect:

    • Electron transport rates

    • Carbon assimilation capacity

    • Energy distribution between photosystems

  • Photoprotective mechanisms: By influencing precursor availability for flavonoid biosynthesis, PPT1 affects the plant's capacity for photoprotection, similar to the reduced UV tolerance observed in ospht2;1 mutants .

These interconnected effects highlight PPT1's role as a critical mediator between carbon fixation, phosphate homeostasis, and downstream metabolic processes in rice.

How does PPT1 function change during phosphate starvation?

During phosphate starvation, PPT1 function undergoes significant adjustments as part of the plant's adaptive response to limited phosphate availability:

Transcriptional and Translational Regulation:

Like other phosphate transporters such as OsPHT2;1, PPT1 expression is likely regulated in response to Pi starvation . This adaptation may involve:

  • Transcriptional upregulation to enhance PEP/Pi exchange efficiency

  • Integration with the broader phosphate starvation response (PSR) network

  • Coordination with PHR1-miR399-PHO2 regulatory pathway that controls other Pi transporters

Functional Adjustments:

  • Transport kinetics may shift to:

    • Maximize Pi retrieval from the cytosol

    • Optimize PEP/Pi exchange ratios

    • Support essential metabolic processes with limited Pi

  • Protein-level regulation likely involves:

    • Post-translational modifications altering transport activity

    • Changes in protein stability and turnover rates

    • Modified interactions with regulatory proteins

Metabolic Integration:

PPT1 function becomes increasingly coordinated with:

  • Vacuolar Pi mobilization through transporters like OsSPX-MFS1

  • Plastid Pi recycling processes

  • Alternative metabolic pathways requiring less Pi

This multifaceted response enables plants to maintain essential functions related to carbon metabolism while adapting to limited phosphate availability. The coordination between PPT1 and other phosphate transporters ensures balanced Pi distribution across subcellular compartments during stress conditions.

What differences exist in PPT1 function between C3 and engineered C4 rice?

The function of PPT1 differs significantly between native C3 rice and engineered C4 rice varieties due to the fundamental differences in carbon fixation biochemistry and cellular architecture:

C3 vs. C4 Metabolic Context:

In C3 rice, PPT1 primarily functions to:

  • Supply PEP for the shikimate pathway in chloroplasts

  • Maintain phosphate homeostasis between compartments

  • Support general chloroplast metabolism

In engineered C4 rice, PPT1 must additionally:

  • Support the compartmentalized C4 photosynthetic pathway

  • Facilitate metabolite shuttling between mesophyll and bundle sheath cells

  • Coordinate with pyruvate-Pi dikinase (PPDK) activity

C4 Engineering Requirements:

The C4 rice consortium's work indicates that successful C4 engineering requires not only installing core biochemical pathways but also ensuring appropriate metabolite transport between specialized cells . For PPT1, this means:

  • Modified expression patterns:

    • Cell-type specific promoters for differential expression

    • Coordinated expression with other C4 cycle components

    • Integration with the suite of membrane transporters illustrated in Figure 1 of source

  • Potential protein modifications:

    • Optimized transport kinetics matching C4 flux requirements

    • Adjusted regulatory properties suitable for C4 metabolism

    • Enhanced coordination with PPDK and other C4-specific enzymes

The successful engineering of C4 photosynthesis in rice requires precise control over metabolite transporters including PPT1, which must be engineered as part of a coordinated system rather than in isolation .

What phenotypes result from PPT1 mutation in rice?

Disruption of PPT1 function through mutation or knockout would have wide-ranging consequences for rice metabolism, development, and stress responses:

Predicted Phenotypic Effects:

Based on studies of related transporters like OsPHT2;1 , PPT1 mutation would likely cause:

These phenotypic effects highlight PPT1's critical role in connecting carbon metabolism, phosphate homeostasis, and stress protection pathways in rice.

How can CRISPR/Cas9 optimize PPT1 for enhanced phosphate efficiency?

CRISPR/Cas9 gene editing offers precise tools to modify PPT1 for improved phosphate use efficiency in rice through several strategic approaches:

Strategic Editing Targets:

  • Promoter modifications:

    • Engineering cis-regulatory elements to enhance expression under Pi limitation

    • Creating conditional expression systems responsive to phosphate status

    • Optimizing tissue-specific expression patterns

  • Protein functional domain alterations:

    • Substrate binding site modifications to improve transport kinetics at low Pi concentrations

    • Regulatory domain adjustments to reduce inhibition under Pi sufficiency

    • Transit peptide optimization for improved chloroplast targeting

Implementation Methodology:

The genetic engineering workflow should include:

  • CRISPR design phase:

    • sgRNA design using tools optimized for rice genome

    • HDR template creation for precise modifications

    • Off-target prediction and minimization

  • Transformation and screening:

    • Agrobacterium-mediated transformation of embryogenic rice callus

    • Selection using appropriate markers

    • Molecular confirmation of edits using sequencing and PCR

  • Validation experiments:

    • Transcript and protein expression analysis

    • In vitro transport assays with isolated chloroplasts

    • Phosphate uptake and distribution studies

Performance Evaluation:

Modified lines require systematic evaluation of:

  • Growth parameters under varying Pi conditions

  • Photosynthetic efficiency measurements

  • Metabolite profiling to assess carbon partitioning

  • Grain yield and nutritional quality

This precision engineering approach could significantly enhance phosphate use efficiency, building on similar strategies that have been successful with other transporters while addressing the specific role of PPT1 in chloroplastic phosphate homeostasis.

How do post-translational modifications regulate PPT1 activity?

Post-translational modifications (PTMs) provide a sophisticated regulatory layer controlling PPT1 activity in response to environmental conditions and metabolic status:

Key Regulatory Modifications:

  • Phosphorylation/dephosphorylation:

    • Primary mechanism for rapid activity regulation

    • Likely mediated by kinases such as:

      • Casein Kinase 2 (CK2), which phosphorylates other phosphate transporters like OsPHT1;8

      • Calcium-dependent protein kinases responding to signaling cascades

      • SnRK family kinases involved in energy and stress signaling

    • Functional consequences include:

      • Altered substrate binding affinity

      • Modified transport velocity

      • Changes in protein-protein interactions

  • Ubiquitination:

    • Controls protein abundance and turnover

    • Possibly mediated by:

      • NLA-mediated degradation systems identified for other Pi transporters

      • PHO2-mediated ubiquitination responding to Pi status

    • Enables rapid adjustment of transporter levels without transcriptional changes

Environmental Response Integration:

PTMs allow PPT1 to integrate signals from:

  • Phosphate availability fluctuations

  • Light/dark transitions affecting photosynthetic activity

  • Stress conditions requiring metabolic adjustments

For example, under phosphate starvation, decreased inhibitory phosphorylation may enhance transport activity, while during phosphate sufficiency, increased modification could reduce activity to prevent over-accumulation.

Research on other phosphate transporters indicates that understanding these regulatory mechanisms could provide valuable targets for engineering more responsive and efficient phosphate transport systems in rice .

How conserved is PPT1 across rice subspecies and cereal crops?

PPT1 demonstrates significant evolutionary conservation across rice subspecies and related cereals, reflecting its essential metabolic role, while also showing subspecies-specific adaptations:

Conservation Analysis:

Sequence analysis would likely reveal:

  • High core domain conservation between:

    • Oryza sativa subsp. japonica

    • Oryza sativa subsp. indica

    • Other cultivated and wild rice species

  • Greatest conservation in:

    • Substrate binding regions

    • Transmembrane domains

    • Catalytic sites

Function and Regulation Comparison:

Functional studies across subspecies would likely show:

  • Conserved basic transport mechanism

  • Subspecies-specific variations in:

    • Baseline expression levels

    • Responsiveness to environmental stressors

    • Tissue-specific expression patterns

These variations may contribute to subspecies-specific adaptation to different agricultural environments and growth conditions.

Cereal Crop Comparison:

PPT1 orthologs in other cereals like wheat, barley, and maize likely show:

  • Conserved functional domains (>70% sequence identity)

  • Species-specific adaptations in:

    • Regulatory elements controlling expression

    • Kinetic properties adapted to metabolic demands

    • C4 species-specific modifications in maize and sorghum

The high degree of conservation across diverse cereal species highlights PPT1's fundamental importance in plant metabolism, while variations reflect adaptations to different photosynthetic mechanisms and environmental conditions.

How do rice PPT1 and Arabidopsis PPT1 transport mechanisms differ?

Rice (Oryza sativa) PPT1 and Arabidopsis PPT1 share core functional characteristics but exhibit notable differences in transport mechanisms and regulation that reflect their evolutionary divergence:

Structural and Functional Comparisons:

  • Protein architecture:

    • Core transmembrane domains show high conservation

    • Species-specific differences in:

      • Transit peptide sequences

      • Regulatory domains

      • Surface loops interacting with other proteins

  • Transport properties:

    • Rice PPT1 is likely adapted for:

      • Higher temperature optima reflecting tropical/subtropical habitats

      • Potentially different pH optima

      • Integration with rice-specific metabolic networks

    • Arabidopsis PPT1 characteristics:

      • Function across broader temperature ranges

      • Adaptation to temperate climate conditions

      • Integration with Arabidopsis-specific metabolic pathways

Regulatory Differences:

  • Transcriptional control:

    • Distinct promoter elements reflecting different:

      • Environmental adaptation strategies

      • Developmental programs

      • Stress response mechanisms

  • Post-translational regulation:

    • Species-specific modification sites

    • Different regulatory interacting partners

    • Rice-specific regulation potentially involving two-component signaling systems described in result

These differences represent the evolutionary divergence between monocots and dicots, while maintaining the core function of phosphoenolpyruvate/phosphate exchange across the chloroplast envelope.

How has PPT1 evolved compared to other phosphate transporters?

The evolutionary trajectory of PPT1 reflects its specialized function and reveals distinct patterns compared to other phosphate transporter families:

Evolutionary Origins:

PPT1 evolved from an ancestral plastidic transporter gene and diverged from other phosphate transporter families before the monocot-dicot split. The protein family shows clear separation from:

  • PHT1 family plasma membrane transporters (OsPT2, OsPT6, OsPT8)

  • PHT2 family chloroplast phosphate transporters (OsPHT2;1)

  • SPX-MFS family vacuolar transporters

Selection Patterns:

Evolutionary analysis reveals:

  • Strong purifying selection on:

    • Core catalytic domains

    • Substrate binding regions

    • Transmembrane organization

  • More rapid evolution in:

    • Regulatory domains

    • Surface-exposed regions

    • N-terminal targeting sequences

Functional Diversification:

The PPT gene family in rice includes multiple members resulting from:

  • Ancient genome duplication events

  • Subsequent subfunctionalization leading to:

    • Tissue-specific expression patterns

    • Different regulatory properties

    • Specialized metabolic roles

This evolutionary perspective explains how PPT1 maintained its essential function in carbon metabolism while diverging from other phosphate transporter families that evolved along different functional trajectories to support various aspects of phosphate acquisition, distribution, and storage.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.